SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9S4F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1L9S4F9
Domain Number - Region: 247-297
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0536
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L9S4F9
Sequence length 404
Comment (tr|A0A1L9S4F9|A0A1L9S4F9_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OJJ42045.1} KW=Complete proteome; Reference proteome OX=1073090 OS=Penicilliopsis zonata CBS 506.65. GN=ASPZODRAFT_170422 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicilliopsis.
Sequence
MSTEKERLQCPSLFKTIPDLKSAIEGDLFFEGGSHDALHFFLEALKDDNTDPFIKMAIKN
TFRDPSVRQRIEESWKLSYDYHDEKIRQHRMGDEACYDLASWCFKNCSLCSNGLLDNKMI
QPSSYFFWLAFSSGKGGLSQSVLSLVDPESLLVPFSTGKPNEVQRTMFTWAILVPKCFEI
CWERLKPLRETALGLIGPTQKRSILGYADVELAERLRKDGLDLGNLEPEHPSLVLLETLS
GTDPDPMFKWLLDRGLQPPEDLLMHATESNYIAAARWLMSHGNYSQSWRNAALKAAGSTD
QSSAELMSIIVEGAAAELPKDAKLSQDLVIEVVDRACQEKEKFNAIRSVDISQQVADMEH
LAVRKIEALGKAVGKVEVIGTKIKAEEAKLDGLLQALGDMDLRS
Download sequence
Identical sequences A0A1L9S4F9
jgi|Aspzo1|170422|estExt_fgenesh1_pg.C_440011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]