SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9SCF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1L9SCF9
Domain Number - Region: 52-96
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0209
Family Rap30/74 interaction domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L9SCF9
Sequence length 216
Comment (tr|A0A1L9SCF9|A0A1L9SCF9_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OJJ44900.1} KW=Complete proteome; Reference proteome OX=1073090 OS=Penicilliopsis zonata CBS 506.65. GN=ASPZODRAFT_134316 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicilliopsis.
Sequence
MATQLGLRRFSICPLSSGWCRPQHMNRQCRRISPLTQQLRLQSTSDSLPRLAQASVWSMI
IPKFIRNRWSARKSPGVAKKNKEWNPASFYIVIFILIGSQAIRMIGLKNDYAGYTRSTDA
KIRLLKEVIEKIQRGEKVDVEKMLGTGDEAKEREWGEVLREIEEEDSLWHQKASQADHKD
QPPSPAPTESPDTSKSSTVDDEPPKAKRPLRKAGFF
Download sequence
Identical sequences A0A1L9SCF9
jgi|Aspzo1|134316|fgenesh1_kg.12_#_89_#_Locus3674v1rpkm56.66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]