SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9T5G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9T5G2
Domain Number 1 Region: 1214-1433
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-16
Family Ankyrin repeat 0.00076
Further Details:      
 
Domain Number 2 Region: 139-273,300-358
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000019
Family Ankyrin repeat 0.0065
Further Details:      
 
Domain Number 3 Region: 723-832,896-940,1023-1059
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000471
Family Pseudo ankyrin repeat 0.025
Further Details:      
 
Domain Number 4 Region: 300-540
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000117
Family Ankyrin repeat 0.0096
Further Details:      
 
Weak hits

Sequence:  A0A1L9T5G2
Domain Number - Region: 635-672,715-735
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00929
Family Pseudo ankyrin repeat 0.045
Further Details:      
 
Domain Number - Region: 803-885
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0192
Family Ankyrin repeat 0.0071
Further Details:      
 
Domain Number - Region: 979-1068,1107-1162
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0226
Family Ankyrin repeat 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L9T5G2
Sequence length 1706
Comment (tr|A0A1L9T5G2|A0A1L9T5G2_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OJJ54682.1} KW=Complete proteome; Reference proteome OX=1036612 OS=Aspergillus sydowii CBS 593.65. GN=ASPSYDRAFT_35361 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MPQSGRDEGWLRAWCTKHDIAADGFQPQLPLISTYSLSTQKDDEDQANLLLTKASEIRRT
GESKTTAAPGKVKKDKWSYEDYCSVLTEIVNASGSVAVAESVWNSLQLQKPKKARTGRFA
RRQQAGGEETDDLLFLLLCSTMRYKETAMFHFLANAASSDVVNRMLPTALQMRSHRNTQI
LLEENADPNTCSEEFITLVRAGDEEFVRLLLQSQTPIDLATLTSALPDAIQRGNVGVVQL
LLAHGADANADSGIAIEKAIRAKRTDLALLMLMSPNPPLPETLAPIVSYVFFKMEILQDN
KYNLIELLLNGGAAGGSVSLALGGAVLQRWTELVELFIDKGVSINYNKAEAYRYAVHEVD
LEMIRILSRGKLDDDLASEIFGEIDNTKYGSSITNEKWHALAEFLLVQGAAGDVVDEALI
QRVEKRHLSGVNLLLREGASVDYANAAALDKAVASENEEFIDALLHYQPSAQSVNTVFDR
VDGLSPDVKLRITRKLFDAGANGTAVDNILKNAMTQHTGERDREFIQILVDGGADVGQGK
GYLVQLAVQSSDDATLQILLLGFPVPTVLSSCIPLAMDLTDTQRYKIIHMLLHGGARGDE
VSQALVDSIDGTSSGCQLASLLLGTGEANTGFNSGMALKRAIESPNIDFIELLVQYNHLQ
ESDFCACLLVAIDLLQRDRTRLEKIRILLMSVQELSGSTGHAALRHEMEGLKRRDDHTLG
VLHMLLEAGADVNHNQGRIFVDAIELGLFECFKLFLAAHPSFQSLENAFENALSSALRAN
LPLDVRYLQELLATGMPQAALDKALLRTTEERNEELILLLLRHGASVNYQDGAAVRHAVS
KLDLELLVHLLRHDPAAATLNSGFTKAMTLHDIRAKHGCYQLLLKAGPVSQRLLEEALVA
AADGGWMYAATCELLLDHKATPNYAAGTPLCRAIKSANYKIDLIKLFLRYSVTEEAVAAA
LGAAFETLQGETRITTMDLLLAVQKPQLTLDQLLLKAVGYLQAFHGLETNDFQVHAPHCD
QKLIQCLLNASASIFYQGGECILHAVMINDVETLRVLEPYFHGHHGISEIFMTVWGNGKR
ANSHQEEAVLSVLVGAGASGESVDMALLESIKTVSTTPAGFAFIVNLLKAGADVNYGEGA
CLAEAATQANVHVIKELLAYGPRRPNMTRAFPLVFRSGVDAQSLREIAVAFCSHNSAPDL
TYDHPTCGPVLCLMLHTYPNEAELLQYLIDKGSIVDPVVKATLPLSPSEEKVSLLCWALA
QSKAALREDVVGILIKSGADVNFQAALSQSTPLQLAIVGSRTQSVAALLQSHADPSLESN
GISPLSLAASIGDTNIVRQLVNAGAAPGDGSLHEAARMVNVSVLQVLLIEAKQRDYPCSR
FQGRTALAELCMTAGNKPISQLKAAMSLLKNNGDFRRKSKGKSVLHFALDHPNAILVSQA
LLDVFMSEYVNDDFNVFEDGRYRFSPLAYVSRGLNMAPPTQRTGLVDLLLEFECRDRFWA
AEGEQPVDMVGAPEEIMRTLKTQKQRQVRIQEEHEDHERRLMHRRAEQAEELSGLRARHD
LTLDHKREMAGETARLEHETASRQATIASQRYDAELAYMRQVTDLANRRKDDSHYREIEH
RRQLALMEQSQRDENYKIEKQRREEEAAFLQHREGLLTSGYENRARIDRDRYAEQMRLFD
AQKGIMEMNARPKVVKQIAYEADSLD
Download sequence
Identical sequences A0A1L9T5G2
jgi|Aspsy1|35361|fgenesh1_pg.13_#_248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]