SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9TM41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9TM41
Domain Number 1 Region: 1284-1568
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.02e-43
Family WD40-repeat 0.00099
Further Details:      
 
Domain Number 2 Region: 5-156,222-312
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 4.45e-41
Family Purine and uridine phosphorylases 0.0036
Further Details:      
 
Domain Number 3 Region: 363-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000128
Family Atu3015-like 0.047
Further Details:      
 
Weak hits

Sequence:  A0A1L9TM41
Domain Number - Region: 818-952
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000187
Family Ankyrin repeat 0.004
Further Details:      
 
Domain Number - Region: 967-1038,1077-1169
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000667
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L9TM41
Sequence length 1577
Comment (tr|A0A1L9TM41|A0A1L9TM41_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OJJ60506.1} KW=Complete proteome; Reference proteome OX=1036612 OS=Aspergillus sydowii CBS 593.65. GN=ASPSYDRAFT_173200 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MRFTHDDYTVAWICALPIEIAAAKAILDEEHDSLPQPKTDHNVYTLGAISGHNVVLVCLP
AGVYGTVSASTTVSHMVSTYPNIEFGLMVGIGGGVPREYDRAAAADIRLGDIVVSRPTGS
LSGVVQYDYGKTVREGKLQRTGSLNKPPRVLLKAIAHLEGEEVAGKRQVRDILAQIDQGV
GNQFPRPERDMLFKAGYYHENLEANCSACDTDQLVDRPLRSRPDEPYIHYGLIASGDQVM
KDARTRDSIAGELDILCFEMEAAGVMDELPSLVIRGICDYCDSHKHKEWQPYAALAAAAY
AKALLSTVPIIINKNRKPEKVGFTADEEACLQSLFLTDPEDDKNALRRRKGGRATGTCEW
ILETDELMDWLEISKPRGEGGSNVLWLHGNPGTGKSTMAMTMVDEIPRQQAFTKGSKVLV
YFFCDSSSDKQRTAISILRGLIYYLVKQRPYLVKFLLAKYNERKESLNSSFDALWGILME
MGRDAAVEIYCIIDALDECESDSQQDLLRQIHQSFGEQQTAESSLSHLHLLITSRPYPEI
GDYLSHFTNKDLASYSAVENDLRVMIEAKVEDLAARKKYPKSVKEEVSSILEDKAEGTFL
WVGIACSELARPEVRSRNATRTLARMPPGLHALYKQLLNAALVERGDDEDEKETMRTMMK
FVAFARRPLTVLELTALCGLYPDDDDDTRIQFTKELIELCRLIIVIQDEHVRLLHKSVKD
FLVKEELDIEEIKAHADMANHCINHILDAIGIIGDEGISFLKYAIEYWPEHAANADTAWT
VGPQQELFFEPDSRYWAQWQARYNAMMNYNIQNPWWVGFGIFHAAAMWNIIPLILWGLKA
NPEYNDDEFGIMPIFTPLVEAANEGHINVMRVLLNKMPVGVRVSALVIGAAARNEESGLD
MMKLILDREGDHVQVTDWVLASAVGNANTGQKLLQLLLDQQGDQIEPNEMVGIAAMNCWH
GKTIMGPLLDRYDGHMNITEELVQAAAMNRGDGRGVMEFLLDRQGDQLLITENIVRAAAY
NEERGAEIIELLLEREGDGIPVTEAVIEAAARNSIAGRQILILLCGNEQKALVTEKVLKA
AAANHDQGLEIMEFLLNECLETNYCVTPDVLTIALYNQPSAALASLLFERTHEQFDLTED
IWEAAIYNRYSTEHVQLLLQYNMHVVLTERLLMAISTHSWEHRKELIMLFLNAGSRCTVT
KRVLDIIVRWFDADVMVLLLQQPNGQLRVTEQQITAAFPGDNRLRDQDISSLPKAMEPMT
QPSRIALDLPTPASTRRFRLITQSQVLDDHDDEVWSSQFSQDGLSLRTVGCNGRVIVYKT
KTWSIIHDLIAHTQSIRYVAYSHXDTRLAILYVDSLIQIWDTKTYECLQVLHGTTDANEL
HWVTNEEIIILTHYKISHWSTTGSCTYKWPNFFQCPIYYCCITPDGTQLLVSDARQLHVF
DIKTRTKKISFSLDDYAPSFVVDPNSGHLLATLRGGEVQLLDFNLGSVICRYRGNKACGI
RSTIFGSDNSLVISGSSDVCIYVWDRGSGALVDILEGPESGYVNSLSLNPSNPDMFASSG
GDGTVRIWVRKTGELSD
Download sequence
Identical sequences A0A1L9TM41
jgi|Aspsy1|173200|estExt_Genewise1.C_3_t10469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]