SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9TQD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9TQD1
Domain Number 1 Region: 268-381
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000497
Family BTB/POZ domain 0.0047
Further Details:      
 
Weak hits

Sequence:  A0A1L9TQD1
Domain Number - Region: 118-225
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0144
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L9TQD1
Sequence length 424
Comment (tr|A0A1L9TQD1|A0A1L9TQD1_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OJJ61513.1} KW=Complete proteome; Reference proteome OX=1036612 OS=Aspergillus sydowii CBS 593.65. GN=ASPSYDRAFT_1173295 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MASRAAFEINMLAQGLKNMHISDIQARYHLEETTRHQSQSTQEDREAEVALPRGVLHDFK
LEAPNGFERSDEVRMVLTFCENLCIAIKERQRTVEWGIMEKVVQLRSPVHRRIILNVGLE
AAAEDDDLVLAAWILQNEWNTILDFLEKPMYAAAAAGNFDVVCCLMERLMRDDEMDRKIN
AALLGLRETHADAEDHLWMYRVSVIARALDVAIEKEFGDIVNLLMPLFQRVIQDDTGWPV
LQSFREVTIGRYLEFSRAQCMLLISEQRMPRILRDSIRCRLEDSEPFDIVIVAGGKEFMA
HRDILVFWSGFFATCYLSGVTRVPLDEGVSVNTMQRVYNFMYSGIYEDSESDDREQVLKD
LLWVATYMMIPKLADRVKDLLNIGLDLKDEEEDTEGLCRGLAFSCMNDEDDVDGLCRGLT
YSRM
Download sequence
Identical sequences A0A1L9TQD1
jgi|Aspsy1|1173295|MIX19634_60_55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]