SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9V237 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9V237
Domain Number 1 Region: 71-242
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.7e-21
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00047
Further Details:      
 
Domain Number 2 Region: 384-396,439-555
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000536
Family Pseudo ankyrin repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L9V237
Sequence length 634
Comment (tr|A0A1L9V237|A0A1L9V237_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OJJ78013.1} KW=Complete proteome; Reference proteome OX=767769 OS=Aspergillus brasiliensis CBS 101740. GN=ASPBRDRAFT_25629 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MAVGFGANFPSTSTGVATVVSKGVWSTEMEVTTELGGKLTEYNTTTPMQIDNQIQDAPAS
SPRRRKRLLLSTESAFVDNILPSLVQNPDLEIRLITDEPSALLSGASKVPHYMDTVDSQT
FEKKTGARKWLKAKAAELCEWADMLLVAPIDAGALGSMLYGLTNTLTLALLRGWISSKPV
VLIPGMTVSEWHHPLSKRQLREVAEFWPWIRVVSPVLWESVNPEELVQLPWDGLKELHEV
LERTLDLSFSQVYIKPAQLPDSTYPTDISEQTPGDAASTISRHLLHRSSKPEHGPRSLPM
ELWLNIFEDQLHDWEIAKAVGIPTNLPVPKEWQNHLLKMSTPASLEYTILRGSFAAIKKR
IDSLPRWKPLSDLVCHLIFKFSRTDILSYLTENHLDLLWTTSRLTNLPYRASAIYGNPNI
LTWWRDAPALPNKEYIADAMDGASRAGFVNVLEWWRTSGLELRYTERALEAASAEGRVAV
LAWWKAASANAPRSKPIPLKVGKSVLLAAQSGRTASLAWWDASGIPYTHGESVARIASTH
GHVHVLDFWYRLKGAKMIFDSQVLVGPTKNGHDNVLEWWRRSGLRVEFKTCDIEEALEDA
DPVSGAEERVRKWWARNGLNLGVGTSEWMKTKVL
Download sequence
Identical sequences A0A1L9V237
jgi|Aspbr1|25629|fgenesh1_pg.1_#_1161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]