SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L9VQI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9VQI2
Domain Number 1 Region: 70-234
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 6.8e-21
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00032
Further Details:      
 
Domain Number 2 Region: 435-529
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000798
Family Pseudo ankyrin repeat 0.021
Further Details:      
 
Weak hits

Sequence:  A0A1L9VQI2
Domain Number - Region: 370-458
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00131
Family Pseudo ankyrin repeat 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L9VQI2
Sequence length 664
Comment (tr|A0A1L9VQI2|A0A1L9VQI2_ASPGL) Uncharacterized protein {ECO:0000313|EMBL:OJJ86175.1} KW=Complete proteome; Reference proteome OX=1160497 OS=Aspergillus glaucus CBS 516.65. GN=ASPGLDRAFT_1327689 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MAIGFGSNSSATPHNLKTVVSKGFCSTEMEIDGNNEETVNGNRDTGANGISKHDTTTPSP
PRRKRLLLSTESSFVDNVLPSLVQNPEIELRLITDEPSASLAGMNKVPHYMDTVDSQTFE
KKTAARRWLKAKAAELCEWTDMLLVAPIDAGTLGSMLGGLTNTLTLALLRGWKSSKPVVL
IPGMTVCEWEHPLSNKQLNELKRFWPWISIVTPVLFKSKGPDELVQLPWDGLKELHGTIE
KTLGLSFSNDTSNSSKADYAPAVSVDKSAGIITPISRQSQLRLNKTKENGALSLPLELWL
NIFEDNLGDWETAKAVGIPSNLPVPKEWQCHLLKMSAPASLEYTILRGSFAAIKKRIDAL
PRWKPLSDLACHLIFKFSRTDILSYLTENHLDLLWTTSRLTNLPYRASAIYGNPNILTWW
RDAPALPNKEYIADAMDGASRAGFLSVLEWWRTSGLELRYTERALEAASAEGHVHVLEWW
RNASTTAPPTNPLPLKVGKSVLLAAQSGRAESLAWWDASGIPYSHAESVARISSTHGHVH
VLQLWHRLKGAKMIFDCQVLVGPTKNGHDNVLEWWRRSGLRVEFKTCDIEEALEDADPVS
GAEGRVRRWWARNGLNLGHIFFFLHSFSVHSSFRSGVFLSSIHVDDYMVDLRMHVSSWIS
IPNE
Download sequence
Identical sequences A0A1L9VQI2
jgi|Aspgl1|1327689|CE1145004_2288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]