SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M2YHB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M2YHB2
Domain Number 1 Region: 10-90
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000216
Family Cold shock DNA-binding domain-like 0.0004
Further Details:      
 
Domain Number 2 Region: 189-249
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.000000000327
Family eIF-2-alpha, C-terminal domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1M2YHB2
Sequence length 268
Comment (tr|A0A1M2YHB2|A0A1M2YHB2_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:OJT94441.1} KW=Complete proteome; Reference proteome OX=1531428 OS=Candidatus Micrarchaeum sp. AZ1. GN=JJ59_03225 OC=Archaea; Candidatus Micrarchaeota; Candidatus Micrarchaeum.
Sequence
MTEQKQQRNSPRPGELVIAQVSKIMQFGAYCKLLEYNGIEVFIPIREVSSGWIKNIHEFL
HNGQKLVCKITYIDNQKGTIDASIKKVMPKEAKDKLGAYNLEKRFSILVGKMIKETGEEK
NKEKIDNDIVSEFGSYAQLYFDLSEGTKRFKESKMPKKLKDRLREFIDEQNAKKKHRVAY
ILEMVVEDTENGVTMINEALKEAEKADVEISYISSPKYHMVAEGADYKDSEEKVKSAVST
ISAKLKNVELKVEKEKLKKDKEGIFDSD
Download sequence
Identical sequences A0A1L9GU54 A0A1M2YHB2 A0A218ZMB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]