SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M3NLV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M3NLV0
Domain Number 1 Region: 12-170
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 1.57e-44
Family ChuX-like 0.00000942
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1M3NLV0
Sequence length 177
Comment (tr|A0A1M3NLV0|A0A1M3NLV0_9RHIZ) Heme utilization protein HuvX {ECO:0000313|EMBL:OJY34267.1} KW=Complete proteome; Reference proteome OX=1895816 OS=Rhizobiales bacterium 65-9. GN=BGP06_02045 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales.
Sequence
MSALSAAQADPLAAARAALAAKPDGVVDAIARAHGVPTQAVLDMLPGDQRVKIDGARFED
VWQTMTRWGEILFIVNTPDIVLECHGALVKGSSAQGYYNVHGDSPIGGHIKAANCSAIYV
VDRPFHGRRSCSVQFFNGAGEAMFKVFVRRNKERELIPEQLALFEALKSEILNSAAA
Download sequence
Identical sequences A0A1M3NLV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]