SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M3TK33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M3TK33
Domain Number 1 Region: 54-158
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 5.5e-25
Family Steroid-binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1M3TK33
Sequence length 163
Comment (tr|A0A1M3TK33|A0A1M3TK33_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OJZ87085.1} KW=Complete proteome OX=1137211 OS=Aspergillus luchuensis CBS 106.47. GN=ASPFODRAFT_59548 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MGTDDNITEPRTEAAKPRPTVSPLRALPACPAPIVTMVEHEPEPKRFSPKIPVQLDPPKY
DPITVEELSKCDGTDPNRPTLVAIKGIVFDVTRNQAYSPSGQYHVFAGKDPSRALASSSL
KAEDCKPDWYDLEDKEKTVLDEWFTFFSKRYNIVGKVKDATNY
Download sequence
Identical sequences A0A1M3TK33
jgi|Aspfo1|59548|fgenesh1_pm.5_#_40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]