SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M4JB27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M4JB27
Domain Number 1 Region: 17-139
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.64e-18
Family Barwin 0.044
Further Details:      
 
Domain Number 2 Region: 138-211
Classification Level Classification E-value
Superfamily PHL pollen allergen 0.00000000118
Family PHL pollen allergen 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1M4JB27
Sequence length 234
Comment (tr|A0A1M4JB27|A0A1M4JB27_XANCT) Cellulase {ECO:0000313|EMBL:SBV88968.1} KW=Complete proteome OX=134874 OS=Xanthomonas translucens pv. graminis. GN=XTGNCPPB3709_2921 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MHRPGISRNLPLVAGLCLVVIAAPAAAAWNGICKGTATYTSSGYSGGAALLDPIPPKMMI
AALNPKQMNYGGVSAALAGAFLQVQGPRGIATVYVTDLYPEGRNCGLDLSPNAFAAIGDV
SAGHIPISWKVVAAPISGNVVYRIKEGSSQSWAAIQVRNHLYPVVKFEYKKNGEWVSLPK
MPYNHFVGEKMGAQLLEIRLTDIRGQVVTDTLKALPSQGDKGVYFVEGHVQFAK
Download sequence
Identical sequences A0A0K3A072 A0A1M4JB27
WP_009606415.1.13720 WP_009606415.1.1620 WP_009606415.1.31913 WP_009606415.1.4877 WP_009606415.1.5732 WP_009606415.1.57809 WP_009606415.1.61379 WP_009606415.1.75768 WP_009606415.1.88426 WP_009606415.1.91391 WP_009606415.1.93508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]