SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M4MT12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M4MT12
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 2.09e-51
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.0001
Further Details:      
 
Domain Number 2 Region: 140-269
Classification Level Classification E-value
Superfamily Translational machinery components 1.05e-42
Family ERF1/Dom34 middle domain-like 0.00087
Further Details:      
 
Domain Number 3 Region: 272-406
Classification Level Classification E-value
Superfamily L30e-like 5.89e-38
Family ERF1/Dom34 C-terminal domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1M4MT12
Sequence length 407
Comment (tr|A0A1M4MT12|A0A1M4MT12_METWO) Translation termination factor aRF1 {ECO:0000256|HAMAP-Rule:MF_00424} KW=Complete proteome OX=145261 OS=Methanothermobacter wolfeii (Methanobacterium wolfei). GN=MWSIV6_1252 OC=Methanobacteriaceae; Methanothermobacter.
Sequence
MSEVSSKELYEFKRTLQELSEKKGRGTELVSVYIPPDRQISDVAKHMREELSQSANIKSK
QTKKNVQSAIEVIMQRLKLFPRPPEKGLVMFVGMIPRGGPGTEKMETYVFEPPEPIKTYI
YHCNSEFYLEPLQEMLEEKETYGLAVLDRKEATIATLKGKRIDILKTLASGVPGKHKAGG
QSQRRFDRLIDLAAHEFLKRIGDHMNEAFLQIEDLKGIILGGPGHTKDEFLNGDYLHHEL
KKKVITTVDTSYTGEFGIREVIDKSMDVLSEIDVMREKKLVQRFLRELINEDGLASYGER
EVRNHLQMGAVEILLLSEDLKYQRGTYECASCGHRMEKTGKDLPDTDKCPACNDQMRITE
RRDMIDDLVEMAEEVGTEVEIISTETEEGMQLLRAFGGIGAILRYRP
Download sequence
Identical sequences A0A1M4MT12
WP_074359191.1.73653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]