SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M4S7R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M4S7R9
Domain Number 1 Region: 29-145
Classification Level Classification E-value
Superfamily TM1646-like 2.88e-29
Family TM1646-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1M4S7R9
Sequence length 146
Comment (tr|A0A1M4S7R9|A0A1M4S7R9_9THEO) Uncharacterized protein {ECO:0000313|EMBL:SHE28077.1} KW=Complete proteome OX=1123369 OS=Thermoanaerobacter uzonensis DSM 18761. GN=SAMN02745195_00016 OC=Thermoanaerobacteraceae; Thermoanaerobacter.
Sequence
MRIEEVKSPKISSDIKSEYNKSYRVTKRFIDTFDEELDQFHQDKLNGILSEIDSAAQKLK
ENLTLQDLINYKKLVKKFLQETTNGMLKYTKKEYVDSRGRKKIYSLVEKVNDKLEKLTEE
FLKDSKHLELLKMIDDIRGLLIDIYS
Download sequence
Identical sequences A0A1M4S7R9
WP_072966324.1.60332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]