SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M5P3W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1M5P3W8
Domain Number - Region: 2-61
Classification Level Classification E-value
Superfamily BAG domain 0.00029
Family BAG domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1M5P3W8
Sequence length 103
Comment (tr|A0A1M5P3W8|A0A1M5P3W8_PECCA) Protein ElaB {ECO:0000313|EMBL:OYN54290.1} KW=Complete proteome OX=554 OS=Pectobacterium carotovorum (Erwinia carotovora). GN=B7L52_17520 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MAATKKQPEEIRVDDDLKLLSETLDEVLRYTGDQADQAYLDLKKGAEKALLEVKARIGVT
DSYYARAKQVADKADVYVHDKPWHGIGIGATVGLVLGLLLAKR
Download sequence
Identical sequences A0A0H3I271 A0A1M5P3W8 A0A2D3MGI8 J7KYF8
WP_010295366.1.101384 WP_010295366.1.22167 WP_010295366.1.26457 WP_010295366.1.29054 WP_010295366.1.31769 WP_010295366.1.36577 WP_010295366.1.36680 WP_010295366.1.37786 WP_010295366.1.40242 WP_010295366.1.50362 WP_010295366.1.53738 WP_010295366.1.61886 WP_010295366.1.63747 WP_010295366.1.64051 WP_010295366.1.68318 WP_010295366.1.68783 WP_010295366.1.70306 WP_010295366.1.75246 WP_010295366.1.7653 WP_010295366.1.77019 WP_010295366.1.78307 WP_010295366.1.83512 WP_010295366.1.86397 WP_010295366.1.89823 WP_010295366.1.9028 WP_010295366.1.90393 WP_010295366.1.95047 WP_010295366.1.96169 WP_010295366.1.97905 gi|403059266|ref|YP_006647483.1| gi|470153859|ref|YP_006282361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]