SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M6CJY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M6CJY1
Domain Number 1 Region: 19-225
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 1.83e-21
Family Archaeal IMP cyclohydrolase PurO 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1M6CJY1
Sequence length 244
Comment (tr|A0A1M6CJY1|A0A1M6CJY1_9BACT) IMP cyclohydrolase-like protein {ECO:0000313|EMBL:SHI61307.1} KW=Complete proteome; Reference proteome OX=1896216 OS=Fibrobacter sp. UWP2. GN=SAMN05720471_10493 OC=Fibrobacter.
Sequence
MKYTDEAKQNFKALSNNPYPGRGIILGESADGKSYVQVYWIMGRSVNSRNRVFEIEPKTG
FMKTKAFDESKLTDPHLIIYYPARHTADVQIITNGDQTDTIYDAIKLGGTFESALRTRQY
EDDAPNFTPRISGIHYKNASPAVYKLSILKSRNNSEEAGCERMTFEYEKALPGLGHFIST
YETDGSPIPSFNGFPKLMPIFDNAEDTLKKYWAALNKDNKVSLMVKWIDKKTFKAKTLIV
NKNK
Download sequence
Identical sequences A0A1M6CJY1 A0A1M7M610
WP_072811285.1.2240 WP_072811285.1.58683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]