SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M6M988 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M6M988
Domain Number 1 Region: 14-60
Classification Level Classification E-value
Superfamily BAS1536-like 0.0000000262
Family BAS1536-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1M6M988
Sequence length 66
Comment (tr|A0A1M6M988|A0A1M6M988_9CLOT) Spo0E like sporulation regulatory protein {ECO:0000313|EMBL:SHJ80018.1} KW=Complete proteome; Reference proteome OX=1121919 OS=Geosporobacter subterraneus DSM 17957. GN=SAMN02745975_02912 OC=Geosporobacter.
Sequence
MLENTLEKNHELVSLRETIEETRAQLNKMVAIEQNHFNEDILSLSRTLDHMIYRYMALEI
RLKPKV
Download sequence
Identical sequences A0A1M6M988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]