SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M6MTK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M6MTK3
Domain Number 1 Region: 1-230
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 1.96e-58
Family CbiG N-terminal domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 216-343
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 4.97e-38
Family CobE/GbiG C-terminal domain-like 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1M6MTK3
Sequence length 346
Comment (tr|A0A1M6MTK3|A0A1M6MTK3_9CLOT) Cobalt-precorrin 5A hydrolase {ECO:0000313|EMBL:SHJ86709.1} KW=Complete proteome; Reference proteome OX=1121266 OS=Caminicella sporogenes DSM 14501. GN=SAMN02745883_00630 OC=Caminicella.
Sequence
MDKAIITLTKGGMELGLKLLNEYEDSVLYINKRFNFCGDRIYKIEKDIKTLISEIFHKYK
CLIFIMAAGIVVRVIAPHIKSKTTDPAVIVLDEKGKNVISLLSGHLGLANEYTLDIAKLL
KSNPVITTSSDVNKTLAVDIISMKLNCIIENIKDATKVSAHIVNGEMVGIISQINIDFNL
PYNIEIIKNLKDISLYKGIIYITNEKINLPKNLDAVLLRPKNIVVGIGCRKGIDREKIIK
AINDAFCKANKSILSIKKIATIDLKKDEKGIIQAAEYMNVPLEIISSRKILDIEDEFEVS
SFVKKSIGVGAVAEPAAVIASKRGSLILNKTKYNGITIALAEEGEN
Download sequence
Identical sequences A0A1M6MTK3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]