SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M6XII3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M6XII3
Domain Number 1 Region: 181-244
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.00000000000000183
Family Steroid-binding domain 0.016
Further Details:      
 
Domain Number 2 Region: 3-160
Classification Level Classification E-value
Superfamily Ferritin-like 0.00000000744
Family half-ferritin 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1M6XII3
Sequence length 255
Comment (tr|A0A1M6XII3|A0A1M6XII3_9FIRM) Predicted heme/steroid binding protein {ECO:0000313|EMBL:SHL05751.1} KW=Complete proteome; Reference proteome OX=1121421 OS=Desulfotomaculum aeronauticum DSM 10349. GN=SAMN02745123_04035 OC=Desulfotomaculum.
Sequence
MQKDLENLRNAVARELLRAVTLYLKASQEVLNEPFTDGMTYQEYFAHEASDEMLHYLQEL
NLIAQRDPIQQEAFADHNLQAFLTSATAPSFWFGPYYYPSSEREIRWHKTYDYVVESIVT
EMETINLYESYIQETKDKDLKIALTEIVNHEKGDLADFNQMLFSLLSNPPVVQTQQSNGQ
MQFTLAQLTQYNGTNGMPAYIAVSGKVYDVTRVPAWQGGSHYGLMAGRDVTAQFMNCHPA
QGMILNGLPLVGVLV
Download sequence
Identical sequences A0A1M6XII3
WP_072917893.1.25509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]