SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M7XUT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M7XUT6
Domain Number 1 Region: 54-79,109-192
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000011
Family Pseudo ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1M7XUT6
Sequence length 216
Comment (tr|A0A1M7XUT6|A0A1M7XUT6_9VIRU) Ankyrin repeat-containing domain {ECO:0000313|EMBL:SHO33417.1} KW=Complete proteome; Reference proteome OX=1903266 OS=Cedratvirus A11. GN=BQ3484_349 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MEVVLETIFSFSGDYNFTNRQVCREFRELAPKVDSLEYLNQAIHDGYKPENFTPTSELAD
AALDRGLLSLLESCNDFVPEDICEKAAGKGYLHILKWARVQRYPWDYKVCSEAAYNGHLK
VLQWLKDNNCPWSAYTFLSAVAGGHLDILQWCKEQDCPVDGNNCRIAACFGQLDVLKWCV
EQGYPIDVNAYRDASIKKHKHIIQWLEEIGIERPDM
Download sequence
Identical sequences A0A1M7XUT6
YP_009329289.1.13941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]