SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1M7XUW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M7XUW4
Domain Number 1 Region: 68-165
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 2.62e-16
Family Pseudo ankyrin repeat 0.017
Further Details:      
 
Domain Number 2 Region: 4-71
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000615
Family Pseudo ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1M7XUW4
Sequence length 178
Comment (tr|A0A1M7XUW4|A0A1M7XUW4_9VIRU) Ankyrin repeat-containing domain {ECO:0000313|EMBL:SHO33504.1} KW=Complete proteome; Reference proteome OX=1903266 OS=Cedratvirus A11. GN=BQ3484_436 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MLQWVRSENCEWDEDTCSSAAENGHLEVLQWARANGCPWDESTCALAAITGHLKVLQWAR
SQGCPWNKETCRDAAEGGHLEVLKWAHANGCEWDKETCSHAAWSGNLEMLQWVRSKGCPW
GKKTLLEAIKGGHLKVLEWAVNNGCPWNETVRSCALHSSDPEIVEWARNYLCSEDEDY
Download sequence
Identical sequences A0A1M7XUW4
YP_009329376.1.13941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]