SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1N6ZFQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1N6ZFQ2
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.15e-31
Family PA0094-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1N6ZFQ2
Sequence length 144
Comment (tr|A0A1N6ZFQ2|A0A1N6ZFQ2_9PSED) Uncharacterized protein {ECO:0000313|EMBL:SIR25591.1} KW=Complete proteome OX=1855331 OS=Pseudomonas sp. A214. GN=SAMN05216504_0529 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTYRINEFQFQLPPSELLDATINILKFPELGTSLIVSRSLLADGETLQSNLDEQLKRLEK
QVQDLRAQPGVAVRLGANQEVEGIELRSQFNKGNEKVFQFQLALVLPGTRKMLALSYVKA
EKLGDAEAAHWATIKDSLLFDVPA
Download sequence
Identical sequences A0A1N6ZFQ2
WP_076383107.1.73233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]