SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1N7E598 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1N7E598
Domain Number 1 Region: 3-51
Classification Level Classification E-value
Superfamily BAS1536-like 8.63e-16
Family BAS1536-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1N7E598
Sequence length 57
Comment (tr|A0A1N7E598|A0A1N7E598_9BACI) Spo0E like sporulation regulatory protein {ECO:0000313|EMBL:SIR83206.1} KW=Complete proteome OX=1907305 OS=Bacillus sp. RUPDJ. GN=SAMN05880571_0955 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MIREHLLNEIEKKRAELLKIVMTNGMTSNITIELSQELDHLLIQYQKELHTGSWGET
Download sequence
Identical sequences A0A0U0D6I5 A0A1N7E598 A0A223C9B9 A0A268DYF5 A0A2D3L3M7 A7Z559 S6FXR2
gi|530569528|ref|YP_008412743.1| WP_012117647.1.101182 WP_012117647.1.17514 WP_012117647.1.35373 WP_012117647.1.4124 WP_012117647.1.48909 WP_012117647.1.52667 WP_012117647.1.55915 WP_012117647.1.55959 WP_012117647.1.62879 WP_012117647.1.63713 WP_012117647.1.8397 WP_012117647.1.86493 gi|154686205|ref|YP_001421366.1| gi|452855730|ref|YP_007497413.1| 326423.RBAM_017720 gi|568177456|ref|YP_008950204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]