SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1P6BY90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1P6BY90
Domain Number 1 Region: 590-775
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-24
Family Nucleotide and nucleoside kinases 0.00016
Further Details:      
 
Domain Number 2 Region: 138-314
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000709
Family Nucleotide and nucleoside kinases 0.00095
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000968
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1P6BY90
Sequence length 802
Comment (tr|A0A1P6BY90|A0A1P6BY90_BRUMA) Bm3343, isoform b {ECO:0000313|EMBL:CDP94177.1} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=BM_Bm3343 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MGAEAKRYLQEHAIPQLFESLITGLICNKPEDPIEFLESSLSKVRQNPSFEYKWDSFVDK
KVLQEYDQPSVTSGLTVSPTEKPKKKAKSRTPGIKKQVTRVSPNRSVVSSTVITNNKSSF
RPPSVMQTAEAASIPDVPIVLFMGGPGGGKTRHAARVQEALNKFGLVHICMPDMIRVAIA
KYQNSNLEWKEAAQRYQRGELIPNNLALGLVKAEMSKHQGAKAFFLEGFPREARQVESFE
REVKPVNMAMILDYDEITLRHHMESRGLDAEIIDAKIREFKLKTLPSAKYFDDQRLLHLI
PGEQTDQWIFERMKLLIQRAMELGVPVTTSKVASRAESPLQRPDAVATVAEAVAIVEAAV
ATAQTSENRSRSPTKIEVEENETKADPILSSATGTEGEPAATLVLNSPVTARDVTNTTTS
AFEKATSETISEKDKLLTASKRQISRKGNATNESKLAEVRADSAITNTEVRERSQISGIT
SESITQPAPVTPVSTNNAPNVEGSSQSSRQSTKSYTKRTLSKISRTVSQTSKSSETSRRS
AHSVKSESQSAQSIKSETQLIGGPSPDSKSNVSAVDNRFPPGLPNNASAIVIVGPPGSNK
AEISKRIAVRYDGFMYLSMGDLLRKEVQANADDQLWQRIGKKMDAGEAVPTKICRELLYS
KIYDEDNISSGYVIEGYPRTKNQAIDFENQIDRLVSVILIDCTEDFCIETIKKRKKEGIV
VRTDDNPEVINARLQMFKQNTLPMLKYFDDKGKLKVVDGDNNLEKIFEEIVEELDSTILA
KDPKCGGSQSLSEESQKKIAGQ
Download sequence
Identical sequences A0A1P6BY90
Bm3343b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]