SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1P8B103 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1P8B103
Domain Number 1 Region: 27-161
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 5.93e-50
Family Pollen allergen PHL P 1 N-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 142-231
Classification Level Classification E-value
Superfamily PHL pollen allergen 6.15e-33
Family PHL pollen allergen 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1P8B103
Sequence length 237
Comment (tr|A0A1P8B103|A0A1P8B103_ARATH) Barwin-like endoglucanases superfamily protein {ECO:0000313|EMBL:ANM62568.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F13M22.14 OC=Arabidopsis.
Sequence
MISDFFFFVKFLTFLFSLFFFLARGVLLGGACGYGNLYSQGYGVNTAALSTALFNNGFSC
GACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLK
IGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGDINGVSVKGSKTDW
VRMSRNWGQNWQSNAVLIGQSLSFRVTASDRRSSTSWNVAPATWQFGQTFSGKNFRV
Download sequence
Identical sequences A0A1P8B103
NP_001324717.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]