SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q3A0S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q3A0S1
Domain Number 1 Region: 195-312
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-30
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 321-432
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.11e-29
Family cAMP-binding domain 0.00037
Further Details:      
 
Weak hits

Sequence:  A0A1Q3A0S1
Domain Number - Region: 11-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000144
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3A0S1
Sequence length 452
Comment (tr|A0A1Q3A0S1|A0A1Q3A0S1_ZYGRO) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome OX=4956 OS=Zygosaccharomyces rouxii (Candida mogii). GN=ZYGR_0N06890 OC=Zygosaccharomyces.
Sequence
MSLSRSQKIELELFEAEVNRHKPADFLQFSANYFNKRLEQQRLFAKRQESVAESKGVVLF
PQVSEQESSAAADLSKNDVQEEQGDDLADVTFKSPFVGQDPHSTSSSQKGSGQGIFKGGF
NVGQEASHRAGSPMGPRSNDDSGDDNKNNQSQFKRHTGNYKSLPTNFNAERRTSVSAETF
QPGSLDNWTPPYYVEKTPEQLDRLFKAVGGNFLFNKLDTDSKKLIINALEEKRVDKGTEI
IKQGDEGDFFYVVEKGTVDFFVNHHKVNTSNAGSSFGELALMYNSPRASTVIAQTECVLW
ALDRLTFRKILLGSSFQKRLMYDELLKNMPILQSLTTYDRAKLADALDTEYYEPGQEIVR
EGDVGENFYLIEYGECDISKKGQGVINHLNAHDYFGEIALLNDLPRQATVTATKRTKVAT
LGKSGFQRLLGPAVEVLKLNDPTGKSRGLAAA
Download sequence
Identical sequences A0A1Q3A0S1 C5DWM8
559307.ZYRO0D16104g XP_002497130.1.66507 gnl|GLV|ZYRO0D16104g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]