SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q3L0G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q3L0G4
Domain Number 1 Region: 33-97
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.00000000000000222
Family PsbU-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3L0G4
Sequence length 120
Comment (tr|A0A1Q3L0G4|A0A1Q3L0G4_9PROT) Uncharacterized protein {ECO:0000313|EMBL:OJU38868.1} KW=Complete proteome; Reference proteome OX=1895711 OS=Alphaproteobacteria bacterium 65-37. GN=BGN99_03975 OC=Bacteria; Proteobacteria; Alphaproteobacteria.
Sequence
MKFPALLAAAALAFGAVGAFGSVFAQGAGRPALAAPASSLIDLNSASRDDLMTLDGIGEV
RADAIIRARPFRAKTDLVERRLIPEALYEKLADKVMARPVPGQPAPAPAKPGQPAQPKRS
Download sequence
Identical sequences A0A1Q3L0G4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]