SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q3LBY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q3LBY6
Domain Number 1 Region: 15-277
Classification Level Classification E-value
Superfamily ImpE-like 2.09e-66
Family ImpE-like 0.0000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3LBY6
Sequence length 280
Comment (tr|A0A1Q3LBY6|A0A1Q3LBY6_9PROT) Uncharacterized protein {ECO:0000313|EMBL:OJU42836.1} KW=Complete proteome; Reference proteome OX=1895711 OS=Alphaproteobacteria bacterium 65-37. GN=BGN99_13040 OC=Bacteria; Proteobacteria; Alphaproteobacteria.
Sequence
MSNSSSKTSDRGEAGRLFHDGNLAEAVTAATAAVRKAPTDVAARLLLAEFLLFAGSTERV
DTVLDACSEIDPGAAIAVAEFRQLLRGETARRQLFKDGRVPEFIGEPSEAQRLSLAAVVA
LRSGDFQQSAKLAAEAEQARPHPGGTLRGVAFDDMRDADDLLASSFEVITTTGKYFWIAT
DKVASLDLHPMKRPRDLFWRRATMQVIGGPEGDIYLPVLYPPGPDEQQPLSDALKLGRAT
DWRQAGDDGPIRGVGAVTLLVGEDAQTWLEMSDLQLQATA
Download sequence
Identical sequences A0A1Q3LBY6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]