SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q3LCU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Q3LCU9
Domain Number - Region: 59-113
Classification Level Classification E-value
Superfamily Methenyltetrahydrofolate cyclohydrolase-like 0.0392
Family Methenyltetrahydrofolate cyclohydrolase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3LCU9
Sequence length 239
Comment (tr|A0A1Q3LCU9|A0A1Q3LCU9_9MICO) Uncharacterized protein {ECO:0000313|EMBL:OJU43156.1} KW=Complete proteome OX=1895784 OS=Microbacterium sp. 69-7. GN=BGN98_06480 OC=Microbacterium.
Sequence
MTEMESSHPDEPHRGGVAQRLNWLRAGVLGANDGIVSTAAVVVGVAGATAEVMPVLLAGS
AALVGGAISMALGEYVSVSSQRDSEHALIEKERRELADDPEAEFVELVGLYREQGLSEET
ATRVATELTARDALAAHLSAELNIDQDDVVSPWHAAFASAVAFFVGALLPMATILLLPHP
ARLVWTFVSVLLALAVTGYLAAWLGGANRGRAIMRTVIGGALALGATFLVGTLFGTAVG
Download sequence
Identical sequences A0A011UV61 A0A1Q3LCU9
WP_036287036.1.73084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]