SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q3P2Z7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q3P2Z7
Domain Number 1 Region: 22-91,165-199
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000379
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3P2Z7
Sequence length 319
Comment (tr|A0A1Q3P2Z7|A0A1Q3P2Z7_9PROT) Uncharacterized protein {ECO:0000313|EMBL:OJV11933.1} KW=Complete proteome; Reference proteome OX=1895704 OS=Alphaproteobacteria bacterium 33-17. GN=BGO27_00505 OC=Bacteria; Proteobacteria; Alphaproteobacteria.
Sequence
MGDKKNKPNLDVESTIKQGLMEGAASGNIDVIKYATKQIKENKSSLTDYMQKQYDDLGLS
NPLIEASRNGHVNVLKHFVNEGVEVNGGLIADATTNLARLHKNGKVSKEKYEEGIKTLDD
LANRYIAKATLMPAIENGEFMEVKNILDSVSKNPKDRANFLNNTTFDGYKHETPVAVAIK
SGDVRMVDILQKEGAEVEPSSLYMLSRKIQSDKTISAEEKNTQQEILSNVLDRVMAKNGV
ESPAKSGLGNIDLSGVKLDSIKVADNKGKNNTASKGNLQKEVNQIKRTLSQKVLDNPSDK
DVLNAAKAANKPKKAGREV
Download sequence
Identical sequences A0A1Q3P2Z7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]