SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q4B6K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q4B6K4
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 5.23e-18
Family PG0164-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q4B6K4
Sequence length 99
Comment (tr|A0A1Q4B6K4|A0A1Q4B6K4_9MICO) Uncharacterized protein {ECO:0000313|EMBL:OJX98044.1} KW=Complete proteome; Reference proteome OX=1895792 OS=Micrococcales bacterium 73-15. GN=BGO96_14310 OC=Bacteria; Actinobacteria; Micrococcales.
Sequence
MPYEFTARVWKTPPPGVWHFLTVPPDLADEIDERTTGLQGGFGSVKVEVTIGATTWSTSI
FPSKEAASFILPVKQAVRRAEDCEAGTDVVVSLVLVGFE
Download sequence
Identical sequences A0A1Q4B6K4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]