SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q4MMD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q4MMD1
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily YfbU-like 4.18e-56
Family YfbU-like 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q4MMD1
Sequence length 166
Comment (tr|A0A1Q4MMD1|A0A1Q4MMD1_AERSA) Uncharacterized protein {ECO:0000313|EMBL:OKA78437.1} KW=Complete proteome OX=29491 OS=Aeromonas salmonicida subsp. salmonicida. GN=BHR41_00120 OC=Aeromonadaceae; Aeromonas.
Sequence
MNMSHTERLILSNQYEILAKLNPEKAASYQRASTIIARGYCLQILELEKSFGHLDLATCQ
EVIDTLELHHALAISWGNLDGADQSEITASRLEFNGYSRSKERELADYVCFLLEVDKRFP
ELKCPCDELSSDIAMRDKYQRMLTVWRQCPRQYKLSIQEIRKVLAA
Download sequence
Identical sequences A0A1Q4MMD1 A4SR52
382245.ASA_3399 gi|145300281|ref|YP_001143122.1| WP_005311609.1.13540 WP_005311609.1.1406 WP_005311609.1.2366 WP_005311609.1.28352 WP_005311609.1.29842 WP_005311609.1.36887 WP_005311609.1.40195 WP_005311609.1.41377 WP_005311609.1.46813 WP_005311609.1.49611 WP_005311609.1.51485 WP_005311609.1.52154 WP_005311609.1.57660 WP_005311609.1.5833 WP_005311609.1.62078 WP_005311609.1.75420 WP_005311609.1.86551 WP_005311609.1.8755 WP_005311609.1.91946 WP_005311609.1.93610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]