SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q4RFG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q4RFG5
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily XisI-like 3.27e-36
Family XisI-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q4RFG5
Sequence length 124
Comment (tr|A0A1Q4RFG5|A0A1Q4RFG5_9CYAN) XisI protein {ECO:0000313|EMBL:OKH42111.1} KW=Complete proteome; Reference proteome OX=1137096 OS=Calothrix sp. HK-06. GN=NIES2101_33250 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MEKLNYYDIVEKILNPYVNITVGEGAKVESIADRANGHYLIMFVGWRDGAHVYGSLIHID
IKNNQIWIQQDGTQEGIAQQLVKAGVPQSDIVLGYRSPFVRQFSGFGVGVENKSEVKPLK
EVSR
Download sequence
Identical sequences A0A1Q4RFG5
WP_073622816.1.66012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]