SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q6LHW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q6LHW9
Domain Number 1 Region: 6-167
Classification Level Classification E-value
Superfamily BH3703-like 3.66e-26
Family BH3703-like 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q6LHW9
Sequence length 253
Comment (tr|A0A1Q6LHW9|A0A1Q6LHW9_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:OKZ78541.1} KW=Complete proteome; Reference proteome OX=1896979 OS=Clostridium sp. 27_14. GN=BHW01_00865 OC=Clostridium.
Sequence
MLRHTQKIKELYEGIQRHIYSMIPEKWESLYLYASVIEGQKETGELYFYYVPKGILKKKP
VNVYEIPSKFNIDETEYLKLVDALYSKIKELRKEFKRLELGETWSNVTMIIHNARFMVEY
DYENLKENPLTSYERHVIWRCKYLGITFEQLNKEEKEILKKYATGPKILARVERYDAGIY
IKDIKNVVAYNKKEETEILHKKEDKYEKNELTQVNNITKKIKEQEEKYVETEKNNKIRNQ
ILSSVEIEENKEK
Download sequence
Identical sequences A0A1Q6LHW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]