SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q6U3C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Q6U3C8
Domain Number - Region: 19-42
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.0222
Family Cysteine-rich DNA binding domain, (DM domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q6U3C8
Sequence length 70
Comment (tr|A0A1Q6U3C8|A0A1Q6U3C8_9BACT) Uncharacterized protein {ECO:0000313|EMBL:OLA78168.1} KW=Complete proteome OX=1897008 OS=Melainabacteria sp. 35_41. GN=BHW55_02570 OC=unclassified Candidatus Melainabacteria.
Sequence
MEEVFYPQNNGEISGSITQTWTEQALECYSIKCDCKKCSLANGSYSFKCQMPKVIDILIG
VAGKPQINPV
Download sequence
Identical sequences A0A1Q6U3C8 A0A292SMH7 R7LIL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]