SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q7CYR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q7CYR2
Domain Number 1 Region: 81-147
Classification Level Classification E-value
Superfamily PUA domain-like 0.000000000000261
Family PUA domain 0.0045
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.00000000017
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q7CYR2
Sequence length 152
Comment (tr|A0A1Q7CYR2|A0A1Q7CYR2_9ARCH) Queuine tRNA-ribosyltransferase {ECO:0000313|EMBL:OLB92105.1} KW=Complete proteome; Reference proteome OX=1805393 OS=Thaumarchaeota archaeon 13_1_40CM_38_12. GN=AUH25_01340 OC=Archaea; Thaumarchaeota; unclassified Thaumarchaeota.
Sequence
MDPILKIKYTLDVLFGTNTSRCLPRDIKITYSKRTGRIQHIYQNDKLLCTLRTDGGLAIT
PFFAQILMKNKKFRENCLEVDDDSKPFIEDGKSVFCKHVKWCGRNVLIGADVPVLHNDRV
IAVGKAILSSSMIRSLKRGMAVRIRDSLKSPD
Download sequence
Identical sequences A0A1Q7CYR2 A0A1Q7G434 A0A1Q7KT73 A0A1Q7NUT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]