SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q7M351 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q7M351
Domain Number 1 Region: 20-88
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 2.22e-17
Family PsbU-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Q7M351
Sequence length 93
Comment (tr|A0A1Q7M351|A0A1Q7M351_9DELT) Uncharacterized protein {ECO:0000313|EMBL:OLD07068.1} KW=Complete proteome; Reference proteome OX=1805116 OS=Deltaproteobacteria bacterium 13_1_40CM_3_69_14. GN=AUI90_11195 OC=Bacteria; Proteobacteria; Deltaproteobacteria.
Sequence
MAIAVALLFAPSIAFAKTQPADKKASAKKAEKLDLNTASEEELKALPGIGDAYSKKIIEG
RPYKAKDELVEKKIIPKATYAKIKDKVIAHQVK
Download sequence
Identical sequences A0A1Q7M351 A0A1Q7Q065 A0A1Q7Z3J4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]