SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q7PZ68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q7PZ68
Domain Number 1 Region: 9-91
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 4.08e-27
Family TATA-box binding protein (TBP), C-terminal domain 0.0000986
Further Details:      
 
Domain Number 2 Region: 97-179
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 6.12e-27
Family TATA-box binding protein (TBP), C-terminal domain 0.0000732
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q7PZ68
Sequence length 203
Comment (tr|A0A1Q7PZ68|A0A1Q7PZ68_9ARCH) TATA-box factor {ECO:0000256|HAMAP-Rule:MF_00408} KW=Complete proteome; Reference proteome OX=1805014 OS=archaeon 13_1_40CM_2_52_4. GN=AUI51_00745 OC=Archaea.
Sequence
MSDKGRAFINIENVVASVTLKQRIDLNAIVRIFPGVEYRPEQFPGLVYRLKKPKTATLIF
SSGKMVCTGSKSERQAHKAVLKVVDELKKGGIVIVGRPVIVVQNIVASAGLGGTIDLEKV
VYSLKKTMYEPEQFPGLIYRMDEPKVVILIFASGKLVCTGAKKEIQVHIAVNKLQETLEA
KNLIMYEGPEKPRLPPIPTKPAD
Download sequence
Identical sequences A0A1Q7B2Q8 A0A1Q7M684 A0A1Q7PZ68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]