SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q7W0H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q7W0H4
Domain Number 1 Region: 9-170
Classification Level Classification E-value
Superfamily Methenyltetrahydrofolate cyclohydrolase-like 7.32e-32
Family Methenyltetrahydrofolate cyclohydrolase-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q7W0H4
Sequence length 197
Comment (tr|A0A1Q7W0H4|A0A1Q7W0H4_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:OLE24276.1} KW=Complete proteome; Reference proteome OX=1805055 OS=Catenulispora sp. 13_1_20CM_3_70_7. GN=AUG49_13720 OC=Catenulispora.
Sequence
MISARSAPLLDCPVAELLDRLAAKQPTPGGGGAAALTAAMAAGLLGMAARFSTTQLIDAA
SRAAHADRVRAQVAALAEQDAEAYQAVLAAFALPREPDPQVRRRQIRRALERAARVPTEI
AEAASSVAVEAVELAKRGNHNLRGDAFTAAILAAAAARSAAELVRLNVELGNLGADLANR
ATQAAETAAKALAVLDA
Download sequence
Identical sequences A0A1Q7W0H4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]