SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q7YML1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q7YML1
Domain Number 1 Region: 12-69
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000968
Family Preprotein translocase SecE subunit 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Q7YML1
Sequence length 83
Comment (tr|A0A1Q7YML1|A0A1Q7YML1_9EURY) Protein translocase SEC61 complex subunit gamma {ECO:0000313|EMBL:OLE56504.1} KW=Complete proteome; Reference proteome OX=1805135 OS=Euryarchaeota archaeon 13_1_20CM_2_64_92. GN=AUF72_00165 OC=Archaea; Euryarchaeota.
Sequence
MADIVDRSWEVQRRIEERAKRLGKGRYGRVLKMARRPTSDEYSKVVLITGVGIAAIGALG
FVIYLIMRYGPGVFHGIFGYLGL
Download sequence
Identical sequences A0A1Q7TNS3 A0A1Q7YML1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]