SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q8R7Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Q8R7Z6
Domain Number - Region: 125-180
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0331
Family Nuclear receptor ligand-binding domain 0.011
Further Details:      
 
Domain Number - Region: 51-150
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0575
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Q8R7Z6
Sequence length 191
Comment (tr|A0A1Q8R7Z6|A0A1Q8R7Z6_STAAU) UPF0302 protein APW47_03815 {ECO:0000256|HAMAP-Rule:MF_00760} OX=1280 OS=Staphylococcus aureus. GN=APW47_03815 OC=Staphylococcus.
Sequence
MSETLNQIKESFIEYLLFQYRFKSRIAVWVLNYIKVNEAKLANIHFVDTKINHHETLEIA
EVGSHASAIQFTKRNIKLMNTNEIFDYIANHNCAFDIQIHFANVSKREQRLDDLIVAQLT
ESPSYQTYLHDLNSMAIDRHKHALLIDYLLHNIDLSLQMNEKQRFYQLTQILNTLKLVNK
HNQFEDLADDD
Download sequence
Identical sequences A0A0D1IV15 A0A1Q8R7Z6 A0A2H5ANV9 A5ISZ2 A6U1T1 A7X2G1 P67759 P67760 P67761 Q6G9A0
gi|150394011|ref|YP_001316686.1| gi|148267948|ref|YP_001246891.1| gi|387150603|ref|YP_005742167.1| gi|21283081|ref|NP_646169.1| 158878.SAV1462 158879.SA1295 196620.MW1352 282459.SAS1405 359786.SaurJH9_1521 359787.SaurJH1_1550 418127.SAHV_1450 681288.SAAV_1449 gi|156979781|ref|YP_001442040.1| gi|384864687|ref|YP_005750046.1| gi|387780563|ref|YP_005755361.1| gi|15927043|ref|NP_374576.1| gi|514066337|ref|YP_008128257.1| gi|384547704|ref|YP_005736957.1| gi|15924452|ref|NP_371986.1| gi|49486302|ref|YP_043523.1| WP_000005212.1.10006 WP_000005212.1.100084 WP_000005212.1.100117 WP_000005212.1.100122 WP_000005212.1.10014 WP_000005212.1.100171 WP_000005212.1.100184 WP_000005212.1.100235 WP_000005212.1.100310 WP_000005212.1.10032 WP_000005212.1.100335 WP_000005212.1.100357 WP_000005212.1.100366 WP_000005212.1.100384 WP_000005212.1.10046 WP_000005212.1.100464 WP_000005212.1.10050 WP_000005212.1.100535 WP_000005212.1.100551 WP_000005212.1.100562 WP_000005212.1.100582 WP_000005212.1.100596 WP_000005212.1.100693 WP_000005212.1.100699 WP_000005212.1.100704 WP_000005212.1.100719 WP_000005212.1.100823 WP_000005212.1.100832 WP_000005212.1.10085 WP_000005212.1.100860 WP_000005212.1.100888 WP_000005212.1.100922 WP_000005212.1.100934 WP_000005212.1.10097 WP_000005212.1.101002 WP_000005212.1.101019 WP_000005212.1.101027 WP_000005212.1.101058 WP_000005212.1.101068 WP_000005212.1.101071 WP_000005212.1.101072 WP_000005212.1.101103 WP_000005212.1.10111 WP_000005212.1.101160 WP_000005212.1.101192 WP_000005212.1.101329 WP_000005212.1.101330 WP_000005212.1.101379 WP_000005212.1.101397 WP_000005212.1.101406 WP_000005212.1.101414 WP_000005212.1.101440 WP_000005212.1.101441 WP_000005212.1.10148 WP_000005212.1.101511 WP_000005212.1.101567 WP_000005212.1.101598 WP_000005212.1.101617 WP_000005212.1.101645 WP_000005212.1.10165 WP_000005212.1.101661 WP_000005212.1.101691 WP_000005212.1.101704 WP_000005212.1.101728 WP_000005212.1.101745 WP_000005212.1.101778 WP_000005212.1.101813 WP_000005212.1.101820 WP_000005212.1.101825 WP_000005212.1.101852 WP_000005212.1.101902 WP_000005212.1.101906 WP_000005212.1.101943 WP_000005212.1.102064 WP_000005212.1.102065 WP_000005212.1.102066 WP_000005212.1.102070 WP_000005212.1.102096 WP_000005212.1.102123 WP_000005212.1.102130 WP_000005212.1.102132 WP_000005212.1.10238 WP_000005212.1.1025 WP_000005212.1.10274 WP_000005212.1.10301 WP_000005212.1.1031 WP_000005212.1.1032 WP_000005212.1.10343 WP_000005212.1.10355 WP_000005212.1.1043 WP_000005212.1.10436 WP_000005212.1.10478 WP_000005212.1.10481 WP_000005212.1.10526 WP_000005212.1.10624 WP_000005212.1.10644 WP_000005212.1.10749 WP_000005212.1.10751 WP_000005212.1.1077 WP_000005212.1.10783 WP_000005212.1.10841 WP_000005212.1.10858 WP_000005212.1.1087 WP_000005212.1.10919 WP_000005212.1.10928 WP_000005212.1.10942 WP_000005212.1.1097 WP_000005212.1.10976 WP_000005212.1.10979 WP_000005212.1.10985 WP_000005212.1.11001 WP_000005212.1.11067 WP_000005212.1.11069 WP_000005212.1.11073 WP_000005212.1.11076 WP_000005212.1.11083 WP_000005212.1.11084 WP_000005212.1.1115 WP_000005212.1.11162 WP_000005212.1.11220 WP_000005212.1.11228 WP_000005212.1.11234 WP_000005212.1.11261 WP_000005212.1.11282 WP_000005212.1.11286 WP_000005212.1.11312 WP_000005212.1.11322 WP_000005212.1.11333 WP_000005212.1.11378 WP_000005212.1.11403 WP_000005212.1.11447 WP_000005212.1.11451 WP_000005212.1.1147 WP_000005212.1.11504 WP_000005212.1.11513 WP_000005212.1.11556 WP_000005212.1.11571 WP_000005212.1.11611 WP_000005212.1.11640 WP_000005212.1.11646 WP_000005212.1.11655 WP_000005212.1.11663 WP_000005212.1.1171 WP_000005212.1.11730 WP_000005212.1.11736 WP_000005212.1.11768 WP_000005212.1.11837 WP_000005212.1.11884 WP_000005212.1.11903 WP_000005212.1.11969 WP_000005212.1.12019 WP_000005212.1.12042 WP_000005212.1.1210 WP_000005212.1.12149 WP_000005212.1.12170 WP_000005212.1.12175 WP_000005212.1.12193 WP_000005212.1.12194 WP_000005212.1.12234 WP_000005212.1.12256 WP_000005212.1.12330 WP_000005212.1.12361 WP_000005212.1.12366 WP_000005212.1.12391 WP_000005212.1.12436 WP_000005212.1.12437 WP_000005212.1.12508 WP_000005212.1.1252 WP_000005212.1.1257 WP_000005212.1.12597 WP_000005212.1.12598 WP_000005212.1.12608 WP_000005212.1.12618 WP_000005212.1.12668 WP_000005212.1.12685 WP_000005212.1.12733 WP_000005212.1.12737 WP_000005212.1.12770 WP_000005212.1.12780 WP_000005212.1.12788 WP_000005212.1.12829 WP_000005212.1.12858 WP_000005212.1.12904 WP_000005212.1.12918 WP_000005212.1.12920 WP_000005212.1.12977 WP_000005212.1.13013 WP_000005212.1.13062 WP_000005212.1.13154 WP_000005212.1.13164 WP_000005212.1.13169 WP_000005212.1.13189 WP_000005212.1.13228 WP_000005212.1.13243 WP_000005212.1.13250 WP_000005212.1.13317 WP_000005212.1.13326 WP_000005212.1.13355 WP_000005212.1.13379 WP_000005212.1.13381 WP_000005212.1.13405 WP_000005212.1.13448 WP_000005212.1.13514 WP_000005212.1.13554 WP_000005212.1.13598 WP_000005212.1.13612 WP_000005212.1.13650 WP_000005212.1.13665 WP_000005212.1.13668 WP_000005212.1.13670 WP_000005212.1.13679 WP_000005212.1.13680 WP_000005212.1.13787 WP_000005212.1.13879 WP_000005212.1.13897 WP_000005212.1.13933 WP_000005212.1.13986 WP_000005212.1.13987 WP_000005212.1.14010 WP_000005212.1.14025 WP_000005212.1.14076 WP_000005212.1.14097 WP_000005212.1.14143 WP_000005212.1.14163 WP_000005212.1.1420 WP_000005212.1.14201 WP_000005212.1.1425 WP_000005212.1.14281 WP_000005212.1.1429 WP_000005212.1.14305 WP_000005212.1.14342 WP_000005212.1.14358 WP_000005212.1.14397 WP_000005212.1.14412 WP_000005212.1.14535 WP_000005212.1.14546 WP_000005212.1.1457 WP_000005212.1.14577 WP_000005212.1.14596 WP_000005212.1.14639 WP_000005212.1.14666 WP_000005212.1.1468 WP_000005212.1.14696 WP_000005212.1.1471 WP_000005212.1.14729 WP_000005212.1.14734 WP_000005212.1.14774 WP_000005212.1.14825 WP_000005212.1.14846 WP_000005212.1.14868 WP_000005212.1.14874 WP_000005212.1.1490 WP_000005212.1.14924 WP_000005212.1.14967 WP_000005212.1.14970 WP_000005212.1.15015 WP_000005212.1.15029 WP_000005212.1.15098 WP_000005212.1.15108 WP_000005212.1.15173 WP_000005212.1.15185 WP_000005212.1.1520 WP_000005212.1.15241 WP_000005212.1.1525 WP_000005212.1.15268 WP_000005212.1.15269 WP_000005212.1.15294 WP_000005212.1.15296 WP_000005212.1.15389 WP_000005212.1.15403 WP_000005212.1.15421 WP_000005212.1.15478 WP_000005212.1.15507 WP_000005212.1.15533 WP_000005212.1.15544 WP_000005212.1.15546 WP_000005212.1.1558 WP_000005212.1.15590 WP_000005212.1.15601 WP_000005212.1.1564 WP_000005212.1.1569 WP_000005212.1.15691 WP_000005212.1.15722 WP_000005212.1.15753 WP_000005212.1.15785 WP_000005212.1.15812 WP_000005212.1.1586 WP_000005212.1.159 WP_000005212.1.15920 WP_000005212.1.15921 WP_000005212.1.15925 WP_000005212.1.15939 WP_000005212.1.16018 WP_000005212.1.16068 WP_000005212.1.16096 WP_000005212.1.16098 WP_000005212.1.16114 WP_000005212.1.16140 WP_000005212.1.16173 WP_000005212.1.16195 WP_000005212.1.16203 WP_000005212.1.16223 WP_000005212.1.1623 WP_000005212.1.16251 WP_000005212.1.16265 WP_000005212.1.16276 WP_000005212.1.16311 WP_000005212.1.16372 WP_000005212.1.16395 WP_000005212.1.16407 WP_000005212.1.16458 WP_000005212.1.16589 WP_000005212.1.16632 WP_000005212.1.16639 WP_000005212.1.1665 WP_000005212.1.16651 WP_000005212.1.16653 WP_000005212.1.16693 WP_000005212.1.16761 WP_000005212.1.16794 WP_000005212.1.16815 WP_000005212.1.16824 WP_000005212.1.16880 WP_000005212.1.16882 WP_000005212.1.16920 WP_000005212.1.16925 WP_000005212.1.16969 WP_000005212.1.16986 WP_000005212.1.170 WP_000005212.1.17012 WP_000005212.1.17046 WP_000005212.1.17050 WP_000005212.1.17080 WP_000005212.1.17122 WP_000005212.1.17132 WP_000005212.1.17139 WP_000005212.1.17156 WP_000005212.1.17157 WP_000005212.1.17180 WP_000005212.1.17240 WP_000005212.1.1729 WP_000005212.1.17296 WP_000005212.1.17309 WP_000005212.1.17327 WP_000005212.1.1736 WP_000005212.1.1740 WP_000005212.1.1741 WP_000005212.1.17419 WP_000005212.1.17454 WP_000005212.1.1751 WP_000005212.1.17529 WP_000005212.1.17531 WP_000005212.1.1756 WP_000005212.1.17590 WP_000005212.1.17643 WP_000005212.1.1765 WP_000005212.1.17671 WP_000005212.1.17717 WP_000005212.1.17718 WP_000005212.1.17725 WP_000005212.1.17729 WP_000005212.1.17737 WP_000005212.1.17796 WP_000005212.1.17818 WP_000005212.1.17832 WP_000005212.1.17847 WP_000005212.1.17853 WP_000005212.1.17909 WP_000005212.1.17922 WP_000005212.1.17943 WP_000005212.1.17987 WP_000005212.1.18011 WP_000005212.1.18069 WP_000005212.1.18080 WP_000005212.1.18113 WP_000005212.1.18140 WP_000005212.1.18153 WP_000005212.1.18203 WP_000005212.1.18205 WP_000005212.1.18237 WP_000005212.1.18248 WP_000005212.1.18261 WP_000005212.1.18288 WP_000005212.1.1829 WP_000005212.1.18301 WP_000005212.1.18309 WP_000005212.1.18310 WP_000005212.1.18346 WP_000005212.1.18360 WP_000005212.1.18412 WP_000005212.1.18424 WP_000005212.1.18429 WP_000005212.1.1847 WP_000005212.1.18487 WP_000005212.1.185 WP_000005212.1.18506 WP_000005212.1.18527 WP_000005212.1.18539 WP_000005212.1.18560 WP_000005212.1.18570 WP_000005212.1.18590 WP_000005212.1.18591 WP_000005212.1.18632 WP_000005212.1.18679 WP_000005212.1.18741 WP_000005212.1.18777 WP_000005212.1.18792 WP_000005212.1.18818 WP_000005212.1.18819 WP_000005212.1.18834 WP_000005212.1.18882 WP_000005212.1.1892 WP_000005212.1.18965 WP_000005212.1.18974 WP_000005212.1.18996 WP_000005212.1.19022 WP_000005212.1.19052 WP_000005212.1.19082 WP_000005212.1.1911 WP_000005212.1.19259 WP_000005212.1.19301 WP_000005212.1.19322 WP_000005212.1.19399 WP_000005212.1.1940 WP_000005212.1.19430 WP_000005212.1.19450 WP_000005212.1.19497 WP_000005212.1.19537 WP_000005212.1.19555 WP_000005212.1.19575 WP_000005212.1.19577 WP_000005212.1.19611 WP_000005212.1.1964 WP_000005212.1.19643 WP_000005212.1.19653 WP_000005212.1.19701 WP_000005212.1.19725 WP_000005212.1.1974 WP_000005212.1.19748 WP_000005212.1.19792 WP_000005212.1.19816 WP_000005212.1.19848 WP_000005212.1.19891 WP_000005212.1.19904 WP_000005212.1.19912 WP_000005212.1.19921 WP_000005212.1.19977 WP_000005212.1.19980 WP_000005212.1.19981 WP_000005212.1.19982 WP_000005212.1.2 WP_000005212.1.20006 WP_000005212.1.20049 WP_000005212.1.20052 WP_000005212.1.2007 WP_000005212.1.20078 WP_000005212.1.2008 WP_000005212.1.20090 WP_000005212.1.20100 WP_000005212.1.20156 WP_000005212.1.20161 WP_000005212.1.20167 WP_000005212.1.20191 WP_000005212.1.20214 WP_000005212.1.20245 WP_000005212.1.2029 WP_000005212.1.20324 WP_000005212.1.20340 WP_000005212.1.20394 WP_000005212.1.20398 WP_000005212.1.20399 WP_000005212.1.20411 WP_000005212.1.20447 WP_000005212.1.20479 WP_000005212.1.20487 WP_000005212.1.20550 WP_000005212.1.20574 WP_000005212.1.20579 WP_000005212.1.20585 WP_000005212.1.20611 WP_000005212.1.20619 WP_000005212.1.20620 WP_000005212.1.20661 WP_000005212.1.20690 WP_000005212.1.20698 WP_000005212.1.20736 WP_000005212.1.20796 WP_000005212.1.20821 WP_000005212.1.20846 WP_000005212.1.20867 WP_000005212.1.20878 WP_000005212.1.20906 WP_000005212.1.20913 WP_000005212.1.20922 WP_000005212.1.20935 WP_000005212.1.20939 WP_000005212.1.20945 WP_000005212.1.20971 WP_000005212.1.21009 WP_000005212.1.21031 WP_000005212.1.21056 WP_000005212.1.21066 WP_000005212.1.21078 WP_000005212.1.21109 WP_000005212.1.21111 WP_000005212.1.21154 WP_000005212.1.21183 WP_000005212.1.2119 WP_000005212.1.21257 WP_000005212.1.21272 WP_000005212.1.2129 WP_000005212.1.21313 WP_000005212.1.21330 WP_000005212.1.21339 WP_000005212.1.2135 WP_000005212.1.21359 WP_000005212.1.21375 WP_000005212.1.21379 WP_000005212.1.21393 WP_000005212.1.21412 WP_000005212.1.21449 WP_000005212.1.21464 WP_000005212.1.21477 WP_000005212.1.21480 WP_000005212.1.21500 WP_000005212.1.21511 WP_000005212.1.21514 WP_000005212.1.21572 WP_000005212.1.2159 WP_000005212.1.2160 WP_000005212.1.21636 WP_000005212.1.21724 WP_000005212.1.21746 WP_000005212.1.21763 WP_000005212.1.2178 WP_000005212.1.21787 WP_000005212.1.21988 WP_000005212.1.22027 WP_000005212.1.22065 WP_000005212.1.22082 WP_000005212.1.22111 WP_000005212.1.22149 WP_000005212.1.22177 WP_000005212.1.22180 WP_000005212.1.22197 WP_000005212.1.22227 WP_000005212.1.22302 WP_000005212.1.22307 WP_000005212.1.22369 WP_000005212.1.22400 WP_000005212.1.22441 WP_000005212.1.22493 WP_000005212.1.22531 WP_000005212.1.22533 WP_000005212.1.22559 WP_000005212.1.22650 WP_000005212.1.22684 WP_000005212.1.22696 WP_000005212.1.22702 WP_000005212.1.22709 WP_000005212.1.22714 WP_000005212.1.22738 WP_000005212.1.22789 WP_000005212.1.22790 WP_000005212.1.22792 WP_000005212.1.22803 WP_000005212.1.22853 WP_000005212.1.22861 WP_000005212.1.22869 WP_000005212.1.22890 WP_000005212.1.22924 WP_000005212.1.22969 WP_000005212.1.23008 WP_000005212.1.23048 WP_000005212.1.23061 WP_000005212.1.23082 WP_000005212.1.23103 WP_000005212.1.23121 WP_000005212.1.23130 WP_000005212.1.23132 WP_000005212.1.23133 WP_000005212.1.23161 WP_000005212.1.23185 WP_000005212.1.23194 WP_000005212.1.23197 WP_000005212.1.23222 WP_000005212.1.23244 WP_000005212.1.2327 WP_000005212.1.23275 WP_000005212.1.23288 WP_000005212.1.23413 WP_000005212.1.23439 WP_000005212.1.23449 WP_000005212.1.23476 WP_000005212.1.23531 WP_000005212.1.23557 WP_000005212.1.23572 WP_000005212.1.23617 WP_000005212.1.23644 WP_000005212.1.23690 WP_000005212.1.23740 WP_000005212.1.23796 WP_000005212.1.23809 WP_000005212.1.23842 WP_000005212.1.2389 WP_000005212.1.23900 WP_000005212.1.23944 WP_000005212.1.23956 WP_000005212.1.23972 WP_000005212.1.23995 WP_000005212.1.24000 WP_000005212.1.24174 WP_000005212.1.24207 WP_000005212.1.24213 WP_000005212.1.24263 WP_000005212.1.2427 WP_000005212.1.24277 WP_000005212.1.2434 WP_000005212.1.24416 WP_000005212.1.24437 WP_000005212.1.24469 WP_000005212.1.2450 WP_000005212.1.24503 WP_000005212.1.24519 WP_000005212.1.24589 WP_000005212.1.24596 WP_000005212.1.24602 WP_000005212.1.24631 WP_000005212.1.24679 WP_000005212.1.24681 WP_000005212.1.24684 WP_000005212.1.24685 WP_000005212.1.24702 WP_000005212.1.24823 WP_000005212.1.24855 WP_000005212.1.24903 WP_000005212.1.24918 WP_000005212.1.2497 WP_000005212.1.25007 WP_000005212.1.2501 WP_000005212.1.25012 WP_000005212.1.2506 WP_000005212.1.25092 WP_000005212.1.25098 WP_000005212.1.25115 WP_000005212.1.25117 WP_000005212.1.25120 WP_000005212.1.25145 WP_000005212.1.25167 WP_000005212.1.25209 WP_000005212.1.25262 WP_000005212.1.25287 WP_000005212.1.25331 WP_000005212.1.25361 WP_000005212.1.25433 WP_000005212.1.2544 WP_000005212.1.25459 WP_000005212.1.25489 WP_000005212.1.2552 WP_000005212.1.25557 WP_000005212.1.25595 WP_000005212.1.25621 WP_000005212.1.25623 WP_000005212.1.25721 WP_000005212.1.25758 WP_000005212.1.25772 WP_000005212.1.25779 WP_000005212.1.25801 WP_000005212.1.25802 WP_000005212.1.25840 WP_000005212.1.25856 WP_000005212.1.25857 WP_000005212.1.2590 WP_000005212.1.25910 WP_000005212.1.2592 WP_000005212.1.25930 WP_000005212.1.26012 WP_000005212.1.26039 WP_000005212.1.2608 WP_000005212.1.26086 WP_000005212.1.26106 WP_000005212.1.26143 WP_000005212.1.26169 WP_000005212.1.2621 WP_000005212.1.26226 WP_000005212.1.26255 WP_000005212.1.26266 WP_000005212.1.26276 WP_000005212.1.26290 WP_000005212.1.26298 WP_000005212.1.26306 WP_000005212.1.26314 WP_000005212.1.2633 WP_000005212.1.26340 WP_000005212.1.26345 WP_000005212.1.26346 WP_000005212.1.26354 WP_000005212.1.26359 WP_000005212.1.26364 WP_000005212.1.26399 WP_000005212.1.26404 WP_000005212.1.26424 WP_000005212.1.2643 WP_000005212.1.26506 WP_000005212.1.26555 WP_000005212.1.26662 WP_000005212.1.26677 WP_000005212.1.26692 WP_000005212.1.26713 WP_000005212.1.2673 WP_000005212.1.26751 WP_000005212.1.26772 WP_000005212.1.26804 WP_000005212.1.2684 WP_000005212.1.26840 WP_000005212.1.26865 WP_000005212.1.26884 WP_000005212.1.2689 WP_000005212.1.26903 WP_000005212.1.26905 WP_000005212.1.26938 WP_000005212.1.26944 WP_000005212.1.26947 WP_000005212.1.27013 WP_000005212.1.27053 WP_000005212.1.27083 WP_000005212.1.27166 WP_000005212.1.27170 WP_000005212.1.2718 WP_000005212.1.27182 WP_000005212.1.2719 WP_000005212.1.27199 WP_000005212.1.27207 WP_000005212.1.27237 WP_000005212.1.2725 WP_000005212.1.27262 WP_000005212.1.27293 WP_000005212.1.27294 WP_000005212.1.27303 WP_000005212.1.27323 WP_000005212.1.27379 WP_000005212.1.27387 WP_000005212.1.27447 WP_000005212.1.27448 WP_000005212.1.27456 WP_000005212.1.27468 WP_000005212.1.27516 WP_000005212.1.2753 WP_000005212.1.27539 WP_000005212.1.27590 WP_000005212.1.27628 WP_000005212.1.27640 WP_000005212.1.27646 WP_000005212.1.27667 WP_000005212.1.27689 WP_000005212.1.27720 WP_000005212.1.27739 WP_000005212.1.27744 WP_000005212.1.27765 WP_000005212.1.27787 WP_000005212.1.27793 WP_000005212.1.27830 WP_000005212.1.2795 WP_000005212.1.28016 WP_000005212.1.28081 WP_000005212.1.28091 WP_000005212.1.28105 WP_000005212.1.28107 WP_000005212.1.28173 WP_000005212.1.28213 WP_000005212.1.28230 WP_000005212.1.28253 WP_000005212.1.28257 WP_000005212.1.28274 WP_000005212.1.28315 WP_000005212.1.28319 WP_000005212.1.28334 WP_000005212.1.28347 WP_000005212.1.28399 WP_000005212.1.28400 WP_000005212.1.28426 WP_000005212.1.28430 WP_000005212.1.2852 WP_000005212.1.28526 WP_000005212.1.28578 WP_000005212.1.28580 WP_000005212.1.28605 WP_000005212.1.28652 WP_000005212.1.28672 WP_000005212.1.28720 WP_000005212.1.28763 WP_000005212.1.28784 WP_000005212.1.28785 WP_000005212.1.28848 WP_000005212.1.28866 WP_000005212.1.28871 WP_000005212.1.28874 WP_000005212.1.28909 WP_000005212.1.28915 WP_000005212.1.28925 WP_000005212.1.28934 WP_000005212.1.28981 WP_000005212.1.28987 WP_000005212.1.29014 WP_000005212.1.29052 WP_000005212.1.29060 WP_000005212.1.29112 WP_000005212.1.29155 WP_000005212.1.29166 WP_000005212.1.29187 WP_000005212.1.29226 WP_000005212.1.29242 WP_000005212.1.29243 WP_000005212.1.29263 WP_000005212.1.29276 WP_000005212.1.29315 WP_000005212.1.29329 WP_000005212.1.29366 WP_000005212.1.29368 WP_000005212.1.29395 WP_000005212.1.29420 WP_000005212.1.29445 WP_000005212.1.29468 WP_000005212.1.29522 WP_000005212.1.29553 WP_000005212.1.29554 WP_000005212.1.29557 WP_000005212.1.2957 WP_000005212.1.29716 WP_000005212.1.2972 WP_000005212.1.29736 WP_000005212.1.29744 WP_000005212.1.29788 WP_000005212.1.2981 WP_000005212.1.29862 WP_000005212.1.29902 WP_000005212.1.29905 WP_000005212.1.29918 WP_000005212.1.29956 WP_000005212.1.29981 WP_000005212.1.30051 WP_000005212.1.30089 WP_000005212.1.30095 WP_000005212.1.30100 WP_000005212.1.30115 WP_000005212.1.30152 WP_000005212.1.30186 WP_000005212.1.30190 WP_000005212.1.30197 WP_000005212.1.30204 WP_000005212.1.30209 WP_000005212.1.30249 WP_000005212.1.30262 WP_000005212.1.30268 WP_000005212.1.3029 WP_000005212.1.30302 WP_000005212.1.30307 WP_000005212.1.30328 WP_000005212.1.30350 WP_000005212.1.30364 WP_000005212.1.30458 WP_000005212.1.30496 WP_000005212.1.30508 WP_000005212.1.30531 WP_000005212.1.30560 WP_000005212.1.30622 WP_000005212.1.30645 WP_000005212.1.30646 WP_000005212.1.30666 WP_000005212.1.30702 WP_000005212.1.30720 WP_000005212.1.30726 WP_000005212.1.30763 WP_000005212.1.3077 WP_000005212.1.30845 WP_000005212.1.30846 WP_000005212.1.30847 WP_000005212.1.30854 WP_000005212.1.30911 WP_000005212.1.30962 WP_000005212.1.31005 WP_000005212.1.31022 WP_000005212.1.31039 WP_000005212.1.31048 WP_000005212.1.31091 WP_000005212.1.31120 WP_000005212.1.31176 WP_000005212.1.31202 WP_000005212.1.31206 WP_000005212.1.31212 WP_000005212.1.3123 WP_000005212.1.31315 WP_000005212.1.3132 WP_000005212.1.31337 WP_000005212.1.31339 WP_000005212.1.31355 WP_000005212.1.31377 WP_000005212.1.31426 WP_000005212.1.31436 WP_000005212.1.31437 WP_000005212.1.31442 WP_000005212.1.31468 WP_000005212.1.31479 WP_000005212.1.31505 WP_000005212.1.31529 WP_000005212.1.31539 WP_000005212.1.31642 WP_000005212.1.31647 WP_000005212.1.31653 WP_000005212.1.31686 WP_000005212.1.31701 WP_000005212.1.31753 WP_000005212.1.31791 WP_000005212.1.31816 WP_000005212.1.31827 WP_000005212.1.31828 WP_000005212.1.31842 WP_000005212.1.31892 WP_000005212.1.31943 WP_000005212.1.31997 WP_000005212.1.32003 WP_000005212.1.32005 WP_000005212.1.32029 WP_000005212.1.32067 WP_000005212.1.32095 WP_000005212.1.32130 WP_000005212.1.32160 WP_000005212.1.3219 WP_000005212.1.32207 WP_000005212.1.32215 WP_000005212.1.3229 WP_000005212.1.32301 WP_000005212.1.32339 WP_000005212.1.32348 WP_000005212.1.3242 WP_000005212.1.32481 WP_000005212.1.32483 WP_000005212.1.32497 WP_000005212.1.32514 WP_000005212.1.32534 WP_000005212.1.32546 WP_000005212.1.32555 WP_000005212.1.32565 WP_000005212.1.32607 WP_000005212.1.32634 WP_000005212.1.32645 WP_000005212.1.32746 WP_000005212.1.32764 WP_000005212.1.32770 WP_000005212.1.32800 WP_000005212.1.32928 WP_000005212.1.3293 WP_000005212.1.32939 WP_000005212.1.32954 WP_000005212.1.32965 WP_000005212.1.33038 WP_000005212.1.33048 WP_000005212.1.33067 WP_000005212.1.33110 WP_000005212.1.33123 WP_000005212.1.33138 WP_000005212.1.3316 WP_000005212.1.33212 WP_000005212.1.33250 WP_000005212.1.33266 WP_000005212.1.33292 WP_000005212.1.33296 WP_000005212.1.33335 WP_000005212.1.33357 WP_000005212.1.33416 WP_000005212.1.3342 WP_000005212.1.33432 WP_000005212.1.33468 WP_000005212.1.3347 WP_000005212.1.33507 WP_000005212.1.33594 WP_000005212.1.33626 WP_000005212.1.33627 WP_000005212.1.3363 WP_000005212.1.33640 WP_000005212.1.33654 WP_000005212.1.33692 WP_000005212.1.33695 WP_000005212.1.33718 WP_000005212.1.33743 WP_000005212.1.33765 WP_000005212.1.33769 WP_000005212.1.33792 WP_000005212.1.33804 WP_000005212.1.33813 WP_000005212.1.33816 WP_000005212.1.33940 WP_000005212.1.33963 WP_000005212.1.33968 WP_000005212.1.33971 WP_000005212.1.33983 WP_000005212.1.34026 WP_000005212.1.34030 WP_000005212.1.34051 WP_000005212.1.34062 WP_000005212.1.34089 WP_000005212.1.34100 WP_000005212.1.34128 WP_000005212.1.34132 WP_000005212.1.34168 WP_000005212.1.34172 WP_000005212.1.34182 WP_000005212.1.34209 WP_000005212.1.34223 WP_000005212.1.34244 WP_000005212.1.34249 WP_000005212.1.34250 WP_000005212.1.34251 WP_000005212.1.34285 WP_000005212.1.34334 WP_000005212.1.34381 WP_000005212.1.34403 WP_000005212.1.34410 WP_000005212.1.34436 WP_000005212.1.3448 WP_000005212.1.34482 WP_000005212.1.34492 WP_000005212.1.34502 WP_000005212.1.34510 WP_000005212.1.34526 WP_000005212.1.34531 WP_000005212.1.3461 WP_000005212.1.34620 WP_000005212.1.34677 WP_000005212.1.34737 WP_000005212.1.34767 WP_000005212.1.34818 WP_000005212.1.34890 WP_000005212.1.34918 WP_000005212.1.34970 WP_000005212.1.34998 WP_000005212.1.35029 WP_000005212.1.35059 WP_000005212.1.35062 WP_000005212.1.35089 WP_000005212.1.35097 WP_000005212.1.35110 WP_000005212.1.35121 WP_000005212.1.35183 WP_000005212.1.35233 WP_000005212.1.35243 WP_000005212.1.35276 WP_000005212.1.35285 WP_000005212.1.35297 WP_000005212.1.35307 WP_000005212.1.35334 WP_000005212.1.35342 WP_000005212.1.354 WP_000005212.1.35415 WP_000005212.1.35433 WP_000005212.1.35435 WP_000005212.1.3547 WP_000005212.1.35498 WP_000005212.1.35525 WP_000005212.1.35580 WP_000005212.1.35615 WP_000005212.1.35623 WP_000005212.1.35659 WP_000005212.1.35673 WP_000005212.1.3569 WP_000005212.1.35746 WP_000005212.1.35801 WP_000005212.1.35826 WP_000005212.1.35888 WP_000005212.1.35900 WP_000005212.1.35928 WP_000005212.1.35950 WP_000005212.1.36004 WP_000005212.1.36082 WP_000005212.1.36102 WP_000005212.1.36119 WP_000005212.1.36141 WP_000005212.1.3617 WP_000005212.1.36176 WP_000005212.1.36187 WP_000005212.1.36188 WP_000005212.1.36211 WP_000005212.1.36223 WP_000005212.1.36231 WP_000005212.1.36250 WP_000005212.1.36264 WP_000005212.1.36278 WP_000005212.1.36282 WP_000005212.1.36307 WP_000005212.1.36344 WP_000005212.1.36389 WP_000005212.1.36532 WP_000005212.1.36535 WP_000005212.1.3655 WP_000005212.1.36570 WP_000005212.1.36580 WP_000005212.1.36600 WP_000005212.1.36615 WP_000005212.1.36646 WP_000005212.1.3666 WP_000005212.1.36669 WP_000005212.1.36689 WP_000005212.1.36697 WP_000005212.1.36745 WP_000005212.1.3675 WP_000005212.1.36783 WP_000005212.1.36793 WP_000005212.1.36796 WP_000005212.1.36822 WP_000005212.1.36823 WP_000005212.1.3685 WP_000005212.1.36858 WP_000005212.1.3687 WP_000005212.1.36932 WP_000005212.1.36952 WP_000005212.1.36955 WP_000005212.1.36979 WP_000005212.1.36980 WP_000005212.1.36983 WP_000005212.1.36997 WP_000005212.1.37002 WP_000005212.1.37016 WP_000005212.1.3703 WP_000005212.1.37044 WP_000005212.1.37053 WP_000005212.1.37080 WP_000005212.1.37121 WP_000005212.1.37134 WP_000005212.1.37220 WP_000005212.1.37341 WP_000005212.1.37398 WP_000005212.1.37424 WP_000005212.1.37467 WP_000005212.1.37503 WP_000005212.1.37525 WP_000005212.1.37536 WP_000005212.1.37578 WP_000005212.1.37583 WP_000005212.1.37602 WP_000005212.1.37605 WP_000005212.1.37606 WP_000005212.1.37621 WP_000005212.1.37624 WP_000005212.1.3776 WP_000005212.1.37781 WP_000005212.1.37815 WP_000005212.1.37828 WP_000005212.1.3784 WP_000005212.1.37878 WP_000005212.1.37953 WP_000005212.1.37987 WP_000005212.1.38038 WP_000005212.1.38057 WP_000005212.1.38070 WP_000005212.1.38082 WP_000005212.1.3809 WP_000005212.1.38100 WP_000005212.1.38148 WP_000005212.1.38160 WP_000005212.1.38177 WP_000005212.1.3820 WP_000005212.1.38229 WP_000005212.1.38230 WP_000005212.1.38232 WP_000005212.1.38276 WP_000005212.1.38282 WP_000005212.1.38309 WP_000005212.1.38311 WP_000005212.1.38316 WP_000005212.1.38339 WP_000005212.1.38383 WP_000005212.1.38390 WP_000005212.1.3842 WP_000005212.1.38435 WP_000005212.1.38437 WP_000005212.1.38453 WP_000005212.1.38493 WP_000005212.1.3850 WP_000005212.1.3852 WP_000005212.1.38522 WP_000005212.1.38546 WP_000005212.1.38607 WP_000005212.1.38612 WP_000005212.1.38637 WP_000005212.1.3867 WP_000005212.1.38674 WP_000005212.1.38721 WP_000005212.1.38760 WP_000005212.1.38788 WP_000005212.1.38823 WP_000005212.1.38836 WP_000005212.1.38841 WP_000005212.1.38858 WP_000005212.1.38862 WP_000005212.1.38926 WP_000005212.1.38931 WP_000005212.1.38940 WP_000005212.1.38941 WP_000005212.1.38960 WP_000005212.1.38972 WP_000005212.1.38973 WP_000005212.1.38989 WP_000005212.1.390 WP_000005212.1.39012 WP_000005212.1.39014 WP_000005212.1.39020 WP_000005212.1.39043 WP_000005212.1.39053 WP_000005212.1.3906 WP_000005212.1.39089 WP_000005212.1.391 WP_000005212.1.39108 WP_000005212.1.39173 WP_000005212.1.39203 WP_000005212.1.39206 WP_000005212.1.39217 WP_000005212.1.3926 WP_000005212.1.39272 WP_000005212.1.39290 WP_000005212.1.39324 WP_000005212.1.39332 WP_000005212.1.39333 WP_000005212.1.39397 WP_000005212.1.39406 WP_000005212.1.39486 WP_000005212.1.39506 WP_000005212.1.39527 WP_000005212.1.39550 WP_000005212.1.39645 WP_000005212.1.39687 WP_000005212.1.39689 WP_000005212.1.39697 WP_000005212.1.39711 WP_000005212.1.39738 WP_000005212.1.39767 WP_000005212.1.39789 WP_000005212.1.39832 WP_000005212.1.39838 WP_000005212.1.39839 WP_000005212.1.39856 WP_000005212.1.39869 WP_000005212.1.39918 WP_000005212.1.40014 WP_000005212.1.40043 WP_000005212.1.40099 WP_000005212.1.40120 WP_000005212.1.40137 WP_000005212.1.4015 WP_000005212.1.40164 WP_000005212.1.40173 WP_000005212.1.4019 WP_000005212.1.40299 WP_000005212.1.40318 WP_000005212.1.40320 WP_000005212.1.40330 WP_000005212.1.40342 WP_000005212.1.40368 WP_000005212.1.40406 WP_000005212.1.40409 WP_000005212.1.4045 WP_000005212.1.40454 WP_000005212.1.40463 WP_000005212.1.40472 WP_000005212.1.40474 WP_000005212.1.40481 WP_000005212.1.40505 WP_000005212.1.40531 WP_000005212.1.40532 WP_000005212.1.4056 WP_000005212.1.4057 WP_000005212.1.40579 WP_000005212.1.40588 WP_000005212.1.40620 WP_000005212.1.40644 WP_000005212.1.40655 WP_000005212.1.40658 WP_000005212.1.40659 WP_000005212.1.4078 WP_000005212.1.40794 WP_000005212.1.40797 WP_000005212.1.40816 WP_000005212.1.41002 WP_000005212.1.41064 WP_000005212.1.41066 WP_000005212.1.41084 WP_000005212.1.41094 WP_000005212.1.41098 WP_000005212.1.41119 WP_000005212.1.41129 WP_000005212.1.4115 WP_000005212.1.41178 WP_000005212.1.412 WP_000005212.1.41208 WP_000005212.1.41241 WP_000005212.1.41255 WP_000005212.1.41289 WP_000005212.1.4129 WP_000005212.1.41411 WP_000005212.1.41426 WP_000005212.1.41432 WP_000005212.1.41433 WP_000005212.1.41448 WP_000005212.1.41499 WP_000005212.1.41511 WP_000005212.1.41558 WP_000005212.1.41567 WP_000005212.1.41582 WP_000005212.1.41597 WP_000005212.1.41623 WP_000005212.1.41647 WP_000005212.1.41674 WP_000005212.1.41726 WP_000005212.1.41770 WP_000005212.1.41839 WP_000005212.1.4188 WP_000005212.1.41898 WP_000005212.1.41935 WP_000005212.1.41943 WP_000005212.1.41989 WP_000005212.1.420 WP_000005212.1.42015 WP_000005212.1.42017 WP_000005212.1.42028 WP_000005212.1.42064 WP_000005212.1.42087 WP_000005212.1.42125 WP_000005212.1.42137 WP_000005212.1.42198 WP_000005212.1.42269 WP_000005212.1.42286 WP_000005212.1.42305 WP_000005212.1.42336 WP_000005212.1.42355 WP_000005212.1.42403 WP_000005212.1.42436 WP_000005212.1.42459 WP_000005212.1.42481 WP_000005212.1.42510 WP_000005212.1.42575 WP_000005212.1.42593 WP_000005212.1.426 WP_000005212.1.42640 WP_000005212.1.42652 WP_000005212.1.42667 WP_000005212.1.42668 WP_000005212.1.42674 WP_000005212.1.42679 WP_000005212.1.42737 WP_000005212.1.42759 WP_000005212.1.42786 WP_000005212.1.42837 WP_000005212.1.42883 WP_000005212.1.42897 WP_000005212.1.4293 WP_000005212.1.42985 WP_000005212.1.4299 WP_000005212.1.4300 WP_000005212.1.43014 WP_000005212.1.43047 WP_000005212.1.43072 WP_000005212.1.43122 WP_000005212.1.43131 WP_000005212.1.43134 WP_000005212.1.43143 WP_000005212.1.43147 WP_000005212.1.43159 WP_000005212.1.43165 WP_000005212.1.43202 WP_000005212.1.43225 WP_000005212.1.43232 WP_000005212.1.43248 WP_000005212.1.4325 WP_000005212.1.43263 WP_000005212.1.4327 WP_000005212.1.43274 WP_000005212.1.43323 WP_000005212.1.43331 WP_000005212.1.43341 WP_000005212.1.43349 WP_000005212.1.43369 WP_000005212.1.4337 WP_000005212.1.43383 WP_000005212.1.43406 WP_000005212.1.4341 WP_000005212.1.43410 WP_000005212.1.43414 WP_000005212.1.43460 WP_000005212.1.4347 WP_000005212.1.43530 WP_000005212.1.43550 WP_000005212.1.43560 WP_000005212.1.43573 WP_000005212.1.43594 WP_000005212.1.43617 WP_000005212.1.43618 WP_000005212.1.43627 WP_000005212.1.43659 WP_000005212.1.43670 WP_000005212.1.43683 WP_000005212.1.43693 WP_000005212.1.43702 WP_000005212.1.43703 WP_000005212.1.4372 WP_000005212.1.43731 WP_000005212.1.43752 WP_000005212.1.43788 WP_000005212.1.4380 WP_000005212.1.43800 WP_000005212.1.43819 WP_000005212.1.43827 WP_000005212.1.4385 WP_000005212.1.43904 WP_000005212.1.43915 WP_000005212.1.43984 WP_000005212.1.44119 WP_000005212.1.44153 WP_000005212.1.44181 WP_000005212.1.44195 WP_000005212.1.44265 WP_000005212.1.44302 WP_000005212.1.44388 WP_000005212.1.44396 WP_000005212.1.44405 WP_000005212.1.44420 WP_000005212.1.44544 WP_000005212.1.44547 WP_000005212.1.44579 WP_000005212.1.44588 WP_000005212.1.44605 WP_000005212.1.44631 WP_000005212.1.44646 WP_000005212.1.44672 WP_000005212.1.44732 WP_000005212.1.44755 WP_000005212.1.44780 WP_000005212.1.44785 WP_000005212.1.44788 WP_000005212.1.44796 WP_000005212.1.44853 WP_000005212.1.44881 WP_000005212.1.44882 WP_000005212.1.44899 WP_000005212.1.44903 WP_000005212.1.44914 WP_000005212.1.44955 WP_000005212.1.44969 WP_000005212.1.45010 WP_000005212.1.45033 WP_000005212.1.45035 WP_000005212.1.45050 WP_000005212.1.45099 WP_000005212.1.45101 WP_000005212.1.4513 WP_000005212.1.45131 WP_000005212.1.45132 WP_000005212.1.45133 WP_000005212.1.45164 WP_000005212.1.45170 WP_000005212.1.452 WP_000005212.1.45218 WP_000005212.1.45272 WP_000005212.1.45290 WP_000005212.1.45297 WP_000005212.1.453 WP_000005212.1.45364 WP_000005212.1.45419 WP_000005212.1.45431 WP_000005212.1.45439 WP_000005212.1.45472 WP_000005212.1.4550 WP_000005212.1.45507 WP_000005212.1.45560 WP_000005212.1.45577 WP_000005212.1.45586 WP_000005212.1.45620 WP_000005212.1.45670 WP_000005212.1.45698 WP_000005212.1.45703 WP_000005212.1.45730 WP_000005212.1.45734 WP_000005212.1.45747 WP_000005212.1.45768 WP_000005212.1.45771 WP_000005212.1.45780 WP_000005212.1.45822 WP_000005212.1.45852 WP_000005212.1.45897 WP_000005212.1.45954 WP_000005212.1.4598 WP_000005212.1.46003 WP_000005212.1.46005 WP_000005212.1.46055 WP_000005212.1.46087 WP_000005212.1.46136 WP_000005212.1.46168 WP_000005212.1.46195 WP_000005212.1.46208 WP_000005212.1.46222 WP_000005212.1.46228 WP_000005212.1.46276 WP_000005212.1.46330 WP_000005212.1.46334 WP_000005212.1.46362 WP_000005212.1.46368 WP_000005212.1.46380 WP_000005212.1.46389 WP_000005212.1.46401 WP_000005212.1.46422 WP_000005212.1.46465 WP_000005212.1.46514 WP_000005212.1.46543 WP_000005212.1.4662 WP_000005212.1.46660 WP_000005212.1.46664 WP_000005212.1.46670 WP_000005212.1.46676 WP_000005212.1.46692 WP_000005212.1.46702 WP_000005212.1.46752 WP_000005212.1.46765 WP_000005212.1.46815 WP_000005212.1.46837 WP_000005212.1.46852 WP_000005212.1.46881 WP_000005212.1.46908 WP_000005212.1.46911 WP_000005212.1.46925 WP_000005212.1.46937 WP_000005212.1.4696 WP_000005212.1.46983 WP_000005212.1.46995 WP_000005212.1.47051 WP_000005212.1.47065 WP_000005212.1.47090 WP_000005212.1.47128 WP_000005212.1.47153 WP_000005212.1.47159 WP_000005212.1.47163 WP_000005212.1.47175 WP_000005212.1.47187 WP_000005212.1.47193 WP_000005212.1.47211 WP_000005212.1.47216 WP_000005212.1.47250 WP_000005212.1.47258 WP_000005212.1.47269 WP_000005212.1.47279 WP_000005212.1.4728 WP_000005212.1.47290 WP_000005212.1.47294 WP_000005212.1.47306 WP_000005212.1.47328 WP_000005212.1.47331 WP_000005212.1.47381 WP_000005212.1.47399 WP_000005212.1.47406 WP_000005212.1.47426 WP_000005212.1.47432 WP_000005212.1.47439 WP_000005212.1.47450 WP_000005212.1.47493 WP_000005212.1.47541 WP_000005212.1.47560 WP_000005212.1.47561 WP_000005212.1.47618 WP_000005212.1.47629 WP_000005212.1.4767 WP_000005212.1.477 WP_000005212.1.47702 WP_000005212.1.47733 WP_000005212.1.47763 WP_000005212.1.47782 WP_000005212.1.47792 WP_000005212.1.47835 WP_000005212.1.47836 WP_000005212.1.47859 WP_000005212.1.47864 WP_000005212.1.47872 WP_000005212.1.47873 WP_000005212.1.47888 WP_000005212.1.47904 WP_000005212.1.47996 WP_000005212.1.48011 WP_000005212.1.48013 WP_000005212.1.48030 WP_000005212.1.48047 WP_000005212.1.4805 WP_000005212.1.48149 WP_000005212.1.4815 WP_000005212.1.48154 WP_000005212.1.48169 WP_000005212.1.48186 WP_000005212.1.48199 WP_000005212.1.48205 WP_000005212.1.48212 WP_000005212.1.48227 WP_000005212.1.48236 WP_000005212.1.48250 WP_000005212.1.48284 WP_000005212.1.48293 WP_000005212.1.48307 WP_000005212.1.48322 WP_000005212.1.48335 WP_000005212.1.48391 WP_000005212.1.48394 WP_000005212.1.48463 WP_000005212.1.48556 WP_000005212.1.48563 WP_000005212.1.48577 WP_000005212.1.48593 WP_000005212.1.48601 WP_000005212.1.48634 WP_000005212.1.48656 WP_000005212.1.4868 WP_000005212.1.48705 WP_000005212.1.48711 WP_000005212.1.48805 WP_000005212.1.48817 WP_000005212.1.48823 WP_000005212.1.48833 WP_000005212.1.48835 WP_000005212.1.4886 WP_000005212.1.48936 WP_000005212.1.48941 WP_000005212.1.48943 WP_000005212.1.48945 WP_000005212.1.48951 WP_000005212.1.48968 WP_000005212.1.48982 WP_000005212.1.48993 WP_000005212.1.4901 WP_000005212.1.49032 WP_000005212.1.4905 WP_000005212.1.49128 WP_000005212.1.49129 WP_000005212.1.49152 WP_000005212.1.49159 WP_000005212.1.4916 WP_000005212.1.49161 WP_000005212.1.4917 WP_000005212.1.4918 WP_000005212.1.49207 WP_000005212.1.49248 WP_000005212.1.49327 WP_000005212.1.49367 WP_000005212.1.49373 WP_000005212.1.49398 WP_000005212.1.49479 WP_000005212.1.4950 WP_000005212.1.49539 WP_000005212.1.4962 WP_000005212.1.49653 WP_000005212.1.49669 WP_000005212.1.49730 WP_000005212.1.49742 WP_000005212.1.49757 WP_000005212.1.4980 WP_000005212.1.49800 WP_000005212.1.49860 WP_000005212.1.49863 WP_000005212.1.49871 WP_000005212.1.4989 WP_000005212.1.49894 WP_000005212.1.49907 WP_000005212.1.49912 WP_000005212.1.49921 WP_000005212.1.49934 WP_000005212.1.4994 WP_000005212.1.49970 WP_000005212.1.49982 WP_000005212.1.50013 WP_000005212.1.50038 WP_000005212.1.50039 WP_000005212.1.50061 WP_000005212.1.50076 WP_000005212.1.5013 WP_000005212.1.50138 WP_000005212.1.50217 WP_000005212.1.50219 WP_000005212.1.50261 WP_000005212.1.50313 WP_000005212.1.50314 WP_000005212.1.50356 WP_000005212.1.50369 WP_000005212.1.50425 WP_000005212.1.50430 WP_000005212.1.50477 WP_000005212.1.50536 WP_000005212.1.50555 WP_000005212.1.50578 WP_000005212.1.50595 WP_000005212.1.50660 WP_000005212.1.50768 WP_000005212.1.50799 WP_000005212.1.50820 WP_000005212.1.5087 WP_000005212.1.50884 WP_000005212.1.50896 WP_000005212.1.50937 WP_000005212.1.50962 WP_000005212.1.51031 WP_000005212.1.5108 WP_000005212.1.5109 WP_000005212.1.5110 WP_000005212.1.5111 WP_000005212.1.51152 WP_000005212.1.51220 WP_000005212.1.51236 WP_000005212.1.51245 WP_000005212.1.51250 WP_000005212.1.51282 WP_000005212.1.51295 WP_000005212.1.51306 WP_000005212.1.51310 WP_000005212.1.51346 WP_000005212.1.51365 WP_000005212.1.51376 WP_000005212.1.51403 WP_000005212.1.51454 WP_000005212.1.51456 WP_000005212.1.51465 WP_000005212.1.515 WP_000005212.1.51527 WP_000005212.1.5155 WP_000005212.1.51559 WP_000005212.1.51571 WP_000005212.1.51575 WP_000005212.1.51590 WP_000005212.1.51665 WP_000005212.1.51672 WP_000005212.1.51716 WP_000005212.1.51744 WP_000005212.1.51748 WP_000005212.1.51797 WP_000005212.1.51836 WP_000005212.1.51842 WP_000005212.1.51844 WP_000005212.1.5186 WP_000005212.1.51871 WP_000005212.1.51883 WP_000005212.1.51912 WP_000005212.1.51924 WP_000005212.1.51936 WP_000005212.1.51952 WP_000005212.1.51971 WP_000005212.1.51995 WP_000005212.1.52078 WP_000005212.1.5209 WP_000005212.1.521 WP_000005212.1.5213 WP_000005212.1.52151 WP_000005212.1.52182 WP_000005212.1.52185 WP_000005212.1.52193 WP_000005212.1.52224 WP_000005212.1.52251 WP_000005212.1.5228 WP_000005212.1.52296 WP_000005212.1.523 WP_000005212.1.5231 WP_000005212.1.52322 WP_000005212.1.52327 WP_000005212.1.52331 WP_000005212.1.52340 WP_000005212.1.52423 WP_000005212.1.52436 WP_000005212.1.52440 WP_000005212.1.52442 WP_000005212.1.52463 WP_000005212.1.52464 WP_000005212.1.52518 WP_000005212.1.52548 WP_000005212.1.52595 WP_000005212.1.52623 WP_000005212.1.52624 WP_000005212.1.52633 WP_000005212.1.52645 WP_000005212.1.52670 WP_000005212.1.52687 WP_000005212.1.52699 WP_000005212.1.52715 WP_000005212.1.52722 WP_000005212.1.52751 WP_000005212.1.52848 WP_000005212.1.52877 WP_000005212.1.52878 WP_000005212.1.52886 WP_000005212.1.52941 WP_000005212.1.52947 WP_000005212.1.52984 WP_000005212.1.53002 WP_000005212.1.53071 WP_000005212.1.53140 WP_000005212.1.53153 WP_000005212.1.53178 WP_000005212.1.53209 WP_000005212.1.5321 WP_000005212.1.5323 WP_000005212.1.53260 WP_000005212.1.53285 WP_000005212.1.53317 WP_000005212.1.53319 WP_000005212.1.53323 WP_000005212.1.53352 WP_000005212.1.53372 WP_000005212.1.53387 WP_000005212.1.53394 WP_000005212.1.53403 WP_000005212.1.53418 WP_000005212.1.53432 WP_000005212.1.53462 WP_000005212.1.53488 WP_000005212.1.53503 WP_000005212.1.53521 WP_000005212.1.53577 WP_000005212.1.53641 WP_000005212.1.53648 WP_000005212.1.53671 WP_000005212.1.53691 WP_000005212.1.53759 WP_000005212.1.53766 WP_000005212.1.53827 WP_000005212.1.53835 WP_000005212.1.53889 WP_000005212.1.53915 WP_000005212.1.53934 WP_000005212.1.53969 WP_000005212.1.53999 WP_000005212.1.5401 WP_000005212.1.54022 WP_000005212.1.54109 WP_000005212.1.54147 WP_000005212.1.54161 WP_000005212.1.54229 WP_000005212.1.54253 WP_000005212.1.54297 WP_000005212.1.54395 WP_000005212.1.544 WP_000005212.1.54413 WP_000005212.1.54446 WP_000005212.1.54491 WP_000005212.1.54503 WP_000005212.1.54510 WP_000005212.1.54543 WP_000005212.1.54551 WP_000005212.1.54637 WP_000005212.1.54675 WP_000005212.1.54689 WP_000005212.1.5469 WP_000005212.1.54728 WP_000005212.1.54745 WP_000005212.1.54753 WP_000005212.1.54878 WP_000005212.1.54955 WP_000005212.1.55014 WP_000005212.1.55100 WP_000005212.1.5519 WP_000005212.1.55214 WP_000005212.1.55272 WP_000005212.1.55274 WP_000005212.1.55309 WP_000005212.1.55353 WP_000005212.1.5536 WP_000005212.1.55367 WP_000005212.1.55369 WP_000005212.1.55403 WP_000005212.1.55405 WP_000005212.1.55421 WP_000005212.1.55508 WP_000005212.1.5554 WP_000005212.1.55544 WP_000005212.1.55558 WP_000005212.1.5556 WP_000005212.1.55583 WP_000005212.1.5559 WP_000005212.1.5562 WP_000005212.1.55628 WP_000005212.1.55637 WP_000005212.1.55653 WP_000005212.1.55657 WP_000005212.1.557 WP_000005212.1.55717 WP_000005212.1.55728 WP_000005212.1.55784 WP_000005212.1.55786 WP_000005212.1.5580 WP_000005212.1.55818 WP_000005212.1.55831 WP_000005212.1.55835 WP_000005212.1.55867 WP_000005212.1.55886 WP_000005212.1.5589 WP_000005212.1.55904 WP_000005212.1.55916 WP_000005212.1.55933 WP_000005212.1.55949 WP_000005212.1.55953 WP_000005212.1.55960 WP_000005212.1.56000 WP_000005212.1.56025 WP_000005212.1.56048 WP_000005212.1.56078 WP_000005212.1.56098 WP_000005212.1.56225 WP_000005212.1.5623 WP_000005212.1.56239 WP_000005212.1.56281 WP_000005212.1.56332 WP_000005212.1.56333 WP_000005212.1.5635 WP_000005212.1.5637 WP_000005212.1.56377 WP_000005212.1.56400 WP_000005212.1.5644 WP_000005212.1.56444 WP_000005212.1.56530 WP_000005212.1.56558 WP_000005212.1.5658 WP_000005212.1.56598 WP_000005212.1.566 WP_000005212.1.56628 WP_000005212.1.56641 WP_000005212.1.56658 WP_000005212.1.5666 WP_000005212.1.56696 WP_000005212.1.56722 WP_000005212.1.56767 WP_000005212.1.5677 WP_000005212.1.56772 WP_000005212.1.56778 WP_000005212.1.56794 WP_000005212.1.56815 WP_000005212.1.56856 WP_000005212.1.5686 WP_000005212.1.56865 WP_000005212.1.56878 WP_000005212.1.569 WP_000005212.1.56986 WP_000005212.1.57024 WP_000005212.1.57047 WP_000005212.1.57073 WP_000005212.1.57075 WP_000005212.1.57080 WP_000005212.1.57097 WP_000005212.1.57109 WP_000005212.1.57170 WP_000005212.1.5718 WP_000005212.1.57190 WP_000005212.1.57196 WP_000005212.1.57214 WP_000005212.1.57265 WP_000005212.1.57309 WP_000005212.1.57389 WP_000005212.1.57445 WP_000005212.1.57459 WP_000005212.1.57481 WP_000005212.1.5749 WP_000005212.1.57577 WP_000005212.1.57594 WP_000005212.1.57650 WP_000005212.1.57665 WP_000005212.1.57682 WP_000005212.1.57692 WP_000005212.1.57723 WP_000005212.1.57730 WP_000005212.1.57734 WP_000005212.1.57754 WP_000005212.1.57808 WP_000005212.1.57819 WP_000005212.1.57837 WP_000005212.1.57840 WP_000005212.1.57861 WP_000005212.1.57875 WP_000005212.1.57878 WP_000005212.1.5791 WP_000005212.1.57943 WP_000005212.1.57944 WP_000005212.1.57952 WP_000005212.1.57974 WP_000005212.1.58016 WP_000005212.1.58035 WP_000005212.1.58049 WP_000005212.1.58074 WP_000005212.1.58116 WP_000005212.1.58127 WP_000005212.1.58148 WP_000005212.1.58158 WP_000005212.1.5816 WP_000005212.1.58277 WP_000005212.1.58317 WP_000005212.1.58321 WP_000005212.1.58352 WP_000005212.1.58364 WP_000005212.1.58395 WP_000005212.1.58419 WP_000005212.1.58430 WP_000005212.1.58435 WP_000005212.1.58495 WP_000005212.1.58497 WP_000005212.1.58504 WP_000005212.1.58512 WP_000005212.1.58530 WP_000005212.1.58538 WP_000005212.1.58549 WP_000005212.1.5857 WP_000005212.1.58571 WP_000005212.1.58592 WP_000005212.1.58598 WP_000005212.1.58626 WP_000005212.1.58704 WP_000005212.1.58718 WP_000005212.1.58735 WP_000005212.1.58760 WP_000005212.1.58763 WP_000005212.1.58772 WP_000005212.1.5880 WP_000005212.1.58833 WP_000005212.1.58855 WP_000005212.1.58934 WP_000005212.1.58981 WP_000005212.1.59011 WP_000005212.1.59014 WP_000005212.1.59039 WP_000005212.1.59046 WP_000005212.1.59062 WP_000005212.1.59077 WP_000005212.1.59098 WP_000005212.1.59124 WP_000005212.1.59146 WP_000005212.1.59157 WP_000005212.1.59187 WP_000005212.1.5920 WP_000005212.1.59311 WP_000005212.1.59337 WP_000005212.1.5938 WP_000005212.1.59380 WP_000005212.1.59398 WP_000005212.1.5940 WP_000005212.1.59404 WP_000005212.1.59462 WP_000005212.1.59464 WP_000005212.1.59489 WP_000005212.1.59498 WP_000005212.1.59540 WP_000005212.1.59546 WP_000005212.1.59547 WP_000005212.1.59598 WP_000005212.1.59624 WP_000005212.1.59643 WP_000005212.1.59668 WP_000005212.1.59669 WP_000005212.1.59671 WP_000005212.1.5972 WP_000005212.1.59736 WP_000005212.1.59787 WP_000005212.1.5982 WP_000005212.1.59822 WP_000005212.1.59874 WP_000005212.1.59907 WP_000005212.1.59915 WP_000005212.1.59921 WP_000005212.1.60006 WP_000005212.1.6006 WP_000005212.1.60101 WP_000005212.1.6011 WP_000005212.1.60123 WP_000005212.1.60147 WP_000005212.1.60149 WP_000005212.1.60157 WP_000005212.1.6017 WP_000005212.1.60201 WP_000005212.1.60227 WP_000005212.1.60302 WP_000005212.1.60345 WP_000005212.1.60353 WP_000005212.1.60360 WP_000005212.1.60431 WP_000005212.1.60434 WP_000005212.1.60492 WP_000005212.1.60547 WP_000005212.1.60585 WP_000005212.1.60595 WP_000005212.1.60636 WP_000005212.1.60641 WP_000005212.1.60734 WP_000005212.1.60750 WP_000005212.1.60751 WP_000005212.1.60758 WP_000005212.1.60759 WP_000005212.1.60765 WP_000005212.1.60778 WP_000005212.1.60813 WP_000005212.1.60820 WP_000005212.1.60845 WP_000005212.1.6085 WP_000005212.1.60869 WP_000005212.1.60888 WP_000005212.1.60912 WP_000005212.1.60917 WP_000005212.1.60923 WP_000005212.1.60946 WP_000005212.1.60948 WP_000005212.1.60965 WP_000005212.1.60982 WP_000005212.1.60991 WP_000005212.1.61009 WP_000005212.1.61013 WP_000005212.1.61023 WP_000005212.1.61026 WP_000005212.1.61029 WP_000005212.1.61031 WP_000005212.1.61082 WP_000005212.1.61107 WP_000005212.1.61115 WP_000005212.1.61139 WP_000005212.1.61189 WP_000005212.1.6119 WP_000005212.1.6123 WP_000005212.1.61263 WP_000005212.1.61271 WP_000005212.1.61286 WP_000005212.1.61289 WP_000005212.1.61313 WP_000005212.1.61316 WP_000005212.1.61327 WP_000005212.1.6136 WP_000005212.1.61375 WP_000005212.1.61393 WP_000005212.1.61394 WP_000005212.1.61430 WP_000005212.1.61439 WP_000005212.1.61440 WP_000005212.1.61555 WP_000005212.1.61585 WP_000005212.1.61597 WP_000005212.1.61615 WP_000005212.1.61639 WP_000005212.1.6166 WP_000005212.1.61705 WP_000005212.1.61749 WP_000005212.1.61800 WP_000005212.1.61802 WP_000005212.1.61831 WP_000005212.1.61838 WP_000005212.1.61897 WP_000005212.1.619 WP_000005212.1.61903 WP_000005212.1.61936 WP_000005212.1.61978 WP_000005212.1.62002 WP_000005212.1.6201 WP_000005212.1.62028 WP_000005212.1.62069 WP_000005212.1.62071 WP_000005212.1.6208 WP_000005212.1.62084 WP_000005212.1.62085 WP_000005212.1.62096 WP_000005212.1.62247 WP_000005212.1.62253 WP_000005212.1.62254 WP_000005212.1.6234 WP_000005212.1.62346 WP_000005212.1.62352 WP_000005212.1.62382 WP_000005212.1.62398 WP_000005212.1.62429 WP_000005212.1.62437 WP_000005212.1.62453 WP_000005212.1.62474 WP_000005212.1.62496 WP_000005212.1.6250 WP_000005212.1.62553 WP_000005212.1.62602 WP_000005212.1.62608 WP_000005212.1.62621 WP_000005212.1.62630 WP_000005212.1.62653 WP_000005212.1.62671 WP_000005212.1.62674 WP_000005212.1.6268 WP_000005212.1.62723 WP_000005212.1.62764 WP_000005212.1.62771 WP_000005212.1.62822 WP_000005212.1.62824 WP_000005212.1.62831 WP_000005212.1.62863 WP_000005212.1.62880 WP_000005212.1.62970 WP_000005212.1.63003 WP_000005212.1.63004 WP_000005212.1.63027 WP_000005212.1.63040 WP_000005212.1.63052 WP_000005212.1.63068 WP_000005212.1.63070 WP_000005212.1.63083 WP_000005212.1.63131 WP_000005212.1.63140 WP_000005212.1.63170 WP_000005212.1.63215 WP_000005212.1.63220 WP_000005212.1.63266 WP_000005212.1.63289 WP_000005212.1.63304 WP_000005212.1.63313 WP_000005212.1.63333 WP_000005212.1.63341 WP_000005212.1.634 WP_000005212.1.63469 WP_000005212.1.63471 WP_000005212.1.63589 WP_000005212.1.63635 WP_000005212.1.63678 WP_000005212.1.63726 WP_000005212.1.63729 WP_000005212.1.6374 WP_000005212.1.63751 WP_000005212.1.63759 WP_000005212.1.63774 WP_000005212.1.63828 WP_000005212.1.63878 WP_000005212.1.6388 WP_000005212.1.63907 WP_000005212.1.63910 WP_000005212.1.63947 WP_000005212.1.63975 WP_000005212.1.63978 WP_000005212.1.6403 WP_000005212.1.6408 WP_000005212.1.64105 WP_000005212.1.64127 WP_000005212.1.64192 WP_000005212.1.64234 WP_000005212.1.64250 WP_000005212.1.64279 WP_000005212.1.64288 WP_000005212.1.64334 WP_000005212.1.64367 WP_000005212.1.6438 WP_000005212.1.64400 WP_000005212.1.64440 WP_000005212.1.64456 WP_000005212.1.64457 WP_000005212.1.64473 WP_000005212.1.64525 WP_000005212.1.64549 WP_000005212.1.64565 WP_000005212.1.64583 WP_000005212.1.6459 WP_000005212.1.64598 WP_000005212.1.6462 WP_000005212.1.64631 WP_000005212.1.64677 WP_000005212.1.64686 WP_000005212.1.64720 WP_000005212.1.64765 WP_000005212.1.6479 WP_000005212.1.64858 WP_000005212.1.64879 WP_000005212.1.6488 WP_000005212.1.64893 WP_000005212.1.64897 WP_000005212.1.64928 WP_000005212.1.64935 WP_000005212.1.64961 WP_000005212.1.64988 WP_000005212.1.64994 WP_000005212.1.65033 WP_000005212.1.65044 WP_000005212.1.65046 WP_000005212.1.65082 WP_000005212.1.65125 WP_000005212.1.65132 WP_000005212.1.65158 WP_000005212.1.65180 WP_000005212.1.65193 WP_000005212.1.65217 WP_000005212.1.65243 WP_000005212.1.65317 WP_000005212.1.65367 WP_000005212.1.65419 WP_000005212.1.65423 WP_000005212.1.65432 WP_000005212.1.65443 WP_000005212.1.65451 WP_000005212.1.6547 WP_000005212.1.65504 WP_000005212.1.6551 WP_000005212.1.65520 WP_000005212.1.65544 WP_000005212.1.65562 WP_000005212.1.65600 WP_000005212.1.65675 WP_000005212.1.65689 WP_000005212.1.65693 WP_000005212.1.65700 WP_000005212.1.65703 WP_000005212.1.65705 WP_000005212.1.65717 WP_000005212.1.65856 WP_000005212.1.65870 WP_000005212.1.65886 WP_000005212.1.65922 WP_000005212.1.65931 WP_000005212.1.65948 WP_000005212.1.66009 WP_000005212.1.66056 WP_000005212.1.66081 WP_000005212.1.661 WP_000005212.1.6612 WP_000005212.1.66120 WP_000005212.1.66133 WP_000005212.1.66175 WP_000005212.1.66262 WP_000005212.1.66287 WP_000005212.1.66302 WP_000005212.1.66322 WP_000005212.1.66433 WP_000005212.1.66505 WP_000005212.1.66519 WP_000005212.1.66542 WP_000005212.1.66564 WP_000005212.1.66588 WP_000005212.1.66601 WP_000005212.1.66606 WP_000005212.1.66664 WP_000005212.1.66677 WP_000005212.1.66711 WP_000005212.1.6674 WP_000005212.1.66786 WP_000005212.1.66818 WP_000005212.1.6684 WP_000005212.1.66879 WP_000005212.1.6700 WP_000005212.1.67112 WP_000005212.1.67135 WP_000005212.1.67191 WP_000005212.1.6722 WP_000005212.1.67266 WP_000005212.1.67329 WP_000005212.1.67333 WP_000005212.1.67379 WP_000005212.1.67384 WP_000005212.1.6740 WP_000005212.1.67414 WP_000005212.1.67463 WP_000005212.1.67480 WP_000005212.1.67505 WP_000005212.1.67507 WP_000005212.1.67520 WP_000005212.1.67521 WP_000005212.1.67554 WP_000005212.1.67572 WP_000005212.1.67632 WP_000005212.1.67651 WP_000005212.1.67652 WP_000005212.1.67713 WP_000005212.1.67722 WP_000005212.1.67754 WP_000005212.1.67762 WP_000005212.1.67815 WP_000005212.1.6786 WP_000005212.1.67865 WP_000005212.1.67925 WP_000005212.1.67986 WP_000005212.1.68033 WP_000005212.1.68054 WP_000005212.1.68066 WP_000005212.1.6811 WP_000005212.1.68111 WP_000005212.1.68160 WP_000005212.1.68161 WP_000005212.1.68199 WP_000005212.1.68261 WP_000005212.1.68286 WP_000005212.1.68296 WP_000005212.1.6830 WP_000005212.1.68307 WP_000005212.1.6834 WP_000005212.1.68367 WP_000005212.1.6839 WP_000005212.1.68397 WP_000005212.1.68404 WP_000005212.1.68425 WP_000005212.1.68483 WP_000005212.1.68489 WP_000005212.1.68505 WP_000005212.1.68522 WP_000005212.1.68565 WP_000005212.1.68636 WP_000005212.1.68650 WP_000005212.1.68657 WP_000005212.1.68699 WP_000005212.1.68703 WP_000005212.1.68728 WP_000005212.1.68737 WP_000005212.1.68775 WP_000005212.1.68813 WP_000005212.1.68831 WP_000005212.1.68854 WP_000005212.1.68864 WP_000005212.1.68875 WP_000005212.1.68944 WP_000005212.1.69045 WP_000005212.1.69087 WP_000005212.1.69089 WP_000005212.1.691 WP_000005212.1.69120 WP_000005212.1.6917 WP_000005212.1.69179 WP_000005212.1.69191 WP_000005212.1.69219 WP_000005212.1.69222 WP_000005212.1.69232 WP_000005212.1.69237 WP_000005212.1.69251 WP_000005212.1.69361 WP_000005212.1.69366 WP_000005212.1.69395 WP_000005212.1.69415 WP_000005212.1.69476 WP_000005212.1.69480 WP_000005212.1.695 WP_000005212.1.6953 WP_000005212.1.69552 WP_000005212.1.69559 WP_000005212.1.69563 WP_000005212.1.69622 WP_000005212.1.69679 WP_000005212.1.69842 WP_000005212.1.69877 WP_000005212.1.69878 WP_000005212.1.69921 WP_000005212.1.69987 WP_000005212.1.70024 WP_000005212.1.70048 WP_000005212.1.70089 WP_000005212.1.70105 WP_000005212.1.7012 WP_000005212.1.70133 WP_000005212.1.70210 WP_000005212.1.7024 WP_000005212.1.70253 WP_000005212.1.70273 WP_000005212.1.703 WP_000005212.1.7034 WP_000005212.1.70344 WP_000005212.1.70349 WP_000005212.1.70353 WP_000005212.1.7043 WP_000005212.1.70459 WP_000005212.1.70462 WP_000005212.1.7053 WP_000005212.1.70546 WP_000005212.1.7061 WP_000005212.1.70611 WP_000005212.1.70635 WP_000005212.1.70641 WP_000005212.1.7067 WP_000005212.1.7073 WP_000005212.1.70807 WP_000005212.1.70818 WP_000005212.1.70823 WP_000005212.1.70829 WP_000005212.1.7089 WP_000005212.1.70924 WP_000005212.1.70930 WP_000005212.1.70939 WP_000005212.1.70943 WP_000005212.1.71043 WP_000005212.1.71058 WP_000005212.1.71059 WP_000005212.1.71073 WP_000005212.1.7109 WP_000005212.1.71130 WP_000005212.1.71143 WP_000005212.1.71196 WP_000005212.1.7120 WP_000005212.1.71236 WP_000005212.1.7125 WP_000005212.1.71257 WP_000005212.1.71295 WP_000005212.1.71298 WP_000005212.1.71325 WP_000005212.1.71345 WP_000005212.1.71359 WP_000005212.1.71419 WP_000005212.1.7150 WP_000005212.1.71519 WP_000005212.1.71529 WP_000005212.1.71543 WP_000005212.1.71590 WP_000005212.1.71596 WP_000005212.1.71602 WP_000005212.1.7161 WP_000005212.1.71662 WP_000005212.1.71676 WP_000005212.1.71735 WP_000005212.1.71780 WP_000005212.1.7179 WP_000005212.1.71861 WP_000005212.1.71925 WP_000005212.1.71989 WP_000005212.1.72026 WP_000005212.1.72031 WP_000005212.1.72067 WP_000005212.1.72112 WP_000005212.1.72169 WP_000005212.1.72176 WP_000005212.1.72205 WP_000005212.1.72224 WP_000005212.1.72271 WP_000005212.1.72315 WP_000005212.1.72330 WP_000005212.1.72347 WP_000005212.1.7236 WP_000005212.1.72366 WP_000005212.1.72424 WP_000005212.1.72446 WP_000005212.1.72547 WP_000005212.1.72564 WP_000005212.1.72626 WP_000005212.1.72654 WP_000005212.1.72750 WP_000005212.1.72787 WP_000005212.1.72832 WP_000005212.1.72834 WP_000005212.1.72835 WP_000005212.1.72903 WP_000005212.1.72904 WP_000005212.1.72935 WP_000005212.1.72945 WP_000005212.1.72965 WP_000005212.1.73017 WP_000005212.1.73019 WP_000005212.1.73022 WP_000005212.1.73037 WP_000005212.1.73122 WP_000005212.1.73132 WP_000005212.1.73246 WP_000005212.1.73265 WP_000005212.1.73286 WP_000005212.1.73386 WP_000005212.1.73402 WP_000005212.1.73456 WP_000005212.1.73501 WP_000005212.1.73571 WP_000005212.1.73591 WP_000005212.1.736 WP_000005212.1.73639 WP_000005212.1.73640 WP_000005212.1.73685 WP_000005212.1.73693 WP_000005212.1.73759 WP_000005212.1.73786 WP_000005212.1.7380 WP_000005212.1.73834 WP_000005212.1.73858 WP_000005212.1.73868 WP_000005212.1.73902 WP_000005212.1.73910 WP_000005212.1.73920 WP_000005212.1.73961 WP_000005212.1.73969 WP_000005212.1.73976 WP_000005212.1.73983 WP_000005212.1.74006 WP_000005212.1.74010 WP_000005212.1.74027 WP_000005212.1.74081 WP_000005212.1.74088 WP_000005212.1.74157 WP_000005212.1.74161 WP_000005212.1.74172 WP_000005212.1.74173 WP_000005212.1.74183 WP_000005212.1.74216 WP_000005212.1.74234 WP_000005212.1.74237 WP_000005212.1.74242 WP_000005212.1.74273 WP_000005212.1.7434 WP_000005212.1.74353 WP_000005212.1.74356 WP_000005212.1.74380 WP_000005212.1.74429 WP_000005212.1.74457 WP_000005212.1.74474 WP_000005212.1.7457 WP_000005212.1.74587 WP_000005212.1.74610 WP_000005212.1.74638 WP_000005212.1.74693 WP_000005212.1.74696 WP_000005212.1.74704 WP_000005212.1.74731 WP_000005212.1.74747 WP_000005212.1.74761 WP_000005212.1.74802 WP_000005212.1.74846 WP_000005212.1.74866 WP_000005212.1.74890 WP_000005212.1.74899 WP_000005212.1.74911 WP_000005212.1.74922 WP_000005212.1.74924 WP_000005212.1.74961 WP_000005212.1.74978 WP_000005212.1.74994 WP_000005212.1.74999 WP_000005212.1.75038 WP_000005212.1.75044 WP_000005212.1.75048 WP_000005212.1.75052 WP_000005212.1.75093 WP_000005212.1.75141 WP_000005212.1.75186 WP_000005212.1.75227 WP_000005212.1.75252 WP_000005212.1.75253 WP_000005212.1.75294 WP_000005212.1.75298 WP_000005212.1.75320 WP_000005212.1.75327 WP_000005212.1.75349 WP_000005212.1.75365 WP_000005212.1.75375 WP_000005212.1.75379 WP_000005212.1.75399 WP_000005212.1.7542 WP_000005212.1.75438 WP_000005212.1.75440 WP_000005212.1.75527 WP_000005212.1.75551 WP_000005212.1.7561 WP_000005212.1.75649 WP_000005212.1.75652 WP_000005212.1.75680 WP_000005212.1.75685 WP_000005212.1.75769 WP_000005212.1.75775 WP_000005212.1.758 WP_000005212.1.75830 WP_000005212.1.75848 WP_000005212.1.75881 WP_000005212.1.75885 WP_000005212.1.75929 WP_000005212.1.75952 WP_000005212.1.7596 WP_000005212.1.75969 WP_000005212.1.76010 WP_000005212.1.76015 WP_000005212.1.7607 WP_000005212.1.76095 WP_000005212.1.76143 WP_000005212.1.76149 WP_000005212.1.76230 WP_000005212.1.76234 WP_000005212.1.7624 WP_000005212.1.7625 WP_000005212.1.76258 WP_000005212.1.76261 WP_000005212.1.76282 WP_000005212.1.76283 WP_000005212.1.76332 WP_000005212.1.76337 WP_000005212.1.76351 WP_000005212.1.76411 WP_000005212.1.76419 WP_000005212.1.76420 WP_000005212.1.76421 WP_000005212.1.76482 WP_000005212.1.765 WP_000005212.1.76528 WP_000005212.1.7658 WP_000005212.1.76606 WP_000005212.1.76624 WP_000005212.1.76648 WP_000005212.1.76686 WP_000005212.1.76690 WP_000005212.1.76693 WP_000005212.1.7675 WP_000005212.1.76790 WP_000005212.1.76792 WP_000005212.1.768 WP_000005212.1.76816 WP_000005212.1.76825 WP_000005212.1.76839 WP_000005212.1.76845 WP_000005212.1.76878 WP_000005212.1.76897 WP_000005212.1.76921 WP_000005212.1.76937 WP_000005212.1.76944 WP_000005212.1.76952 WP_000005212.1.76998 WP_000005212.1.77013 WP_000005212.1.77020 WP_000005212.1.77031 WP_000005212.1.77041 WP_000005212.1.77050 WP_000005212.1.77060 WP_000005212.1.77062 WP_000005212.1.77112 WP_000005212.1.77145 WP_000005212.1.77183 WP_000005212.1.77256 WP_000005212.1.77305 WP_000005212.1.77315 WP_000005212.1.77416 WP_000005212.1.77426 WP_000005212.1.7745 WP_000005212.1.7746 WP_000005212.1.77485 WP_000005212.1.77489 WP_000005212.1.77497 WP_000005212.1.7752 WP_000005212.1.77520 WP_000005212.1.77527 WP_000005212.1.77533 WP_000005212.1.77536 WP_000005212.1.77572 WP_000005212.1.77603 WP_000005212.1.77606 WP_000005212.1.77733 WP_000005212.1.77738 WP_000005212.1.7774 WP_000005212.1.77743 WP_000005212.1.77763 WP_000005212.1.77814 WP_000005212.1.77818 WP_000005212.1.77822 WP_000005212.1.77848 WP_000005212.1.77858 WP_000005212.1.7787 WP_000005212.1.77952 WP_000005212.1.77957 WP_000005212.1.78054 WP_000005212.1.78091 WP_000005212.1.78095 WP_000005212.1.7810 WP_000005212.1.78173 WP_000005212.1.78189 WP_000005212.1.78207 WP_000005212.1.78208 WP_000005212.1.78252 WP_000005212.1.78254 WP_000005212.1.78257 WP_000005212.1.7827 WP_000005212.1.78311 WP_000005212.1.7833 WP_000005212.1.78332 WP_000005212.1.78365 WP_000005212.1.78392 WP_000005212.1.78404 WP_000005212.1.7850 WP_000005212.1.78558 WP_000005212.1.7857 WP_000005212.1.78598 WP_000005212.1.78604 WP_000005212.1.78653 WP_000005212.1.78667 WP_000005212.1.7868 WP_000005212.1.78708 WP_000005212.1.78728 WP_000005212.1.78785 WP_000005212.1.78803 WP_000005212.1.78819 WP_000005212.1.78841 WP_000005212.1.78897 WP_000005212.1.78946 WP_000005212.1.78983 WP_000005212.1.78985 WP_000005212.1.7900 WP_000005212.1.79006 WP_000005212.1.79037 WP_000005212.1.79038 WP_000005212.1.79051 WP_000005212.1.79085 WP_000005212.1.79131 WP_000005212.1.79170 WP_000005212.1.79197 WP_000005212.1.79208 WP_000005212.1.79223 WP_000005212.1.79227 WP_000005212.1.79270 WP_000005212.1.7931 WP_000005212.1.79310 WP_000005212.1.79314 WP_000005212.1.79322 WP_000005212.1.79332 WP_000005212.1.79334 WP_000005212.1.79341 WP_000005212.1.79367 WP_000005212.1.79374 WP_000005212.1.79402 WP_000005212.1.79408 WP_000005212.1.79436 WP_000005212.1.79461 WP_000005212.1.79476 WP_000005212.1.79487 WP_000005212.1.79539 WP_000005212.1.79556 WP_000005212.1.79626 WP_000005212.1.79638 WP_000005212.1.79662 WP_000005212.1.79672 WP_000005212.1.79676 WP_000005212.1.79706 WP_000005212.1.79822 WP_000005212.1.79831 WP_000005212.1.79834 WP_000005212.1.79837 WP_000005212.1.79855 WP_000005212.1.7989 WP_000005212.1.79896 WP_000005212.1.79911 WP_000005212.1.7992 WP_000005212.1.79941 WP_000005212.1.79961 WP_000005212.1.79971 WP_000005212.1.79991 WP_000005212.1.80000 WP_000005212.1.80032 WP_000005212.1.80042 WP_000005212.1.80079 WP_000005212.1.80109 WP_000005212.1.80124 WP_000005212.1.80127 WP_000005212.1.80203 WP_000005212.1.80287 WP_000005212.1.80290 WP_000005212.1.80297 WP_000005212.1.8031 WP_000005212.1.80318 WP_000005212.1.8035 WP_000005212.1.80358 WP_000005212.1.80378 WP_000005212.1.80407 WP_000005212.1.80414 WP_000005212.1.8043 WP_000005212.1.80472 WP_000005212.1.80530 WP_000005212.1.8065 WP_000005212.1.80653 WP_000005212.1.80680 WP_000005212.1.80687 WP_000005212.1.80717 WP_000005212.1.80734 WP_000005212.1.80761 WP_000005212.1.80763 WP_000005212.1.80781 WP_000005212.1.80786 WP_000005212.1.80833 WP_000005212.1.8084 WP_000005212.1.80872 WP_000005212.1.809 WP_000005212.1.80962 WP_000005212.1.81055 WP_000005212.1.81085 WP_000005212.1.81114 WP_000005212.1.81157 WP_000005212.1.81171 WP_000005212.1.81234 WP_000005212.1.8125 WP_000005212.1.81252 WP_000005212.1.81344 WP_000005212.1.8135 WP_000005212.1.81385 WP_000005212.1.81389 WP_000005212.1.8142 WP_000005212.1.8144 WP_000005212.1.81464 WP_000005212.1.81467 WP_000005212.1.81599 WP_000005212.1.81610 WP_000005212.1.81718 WP_000005212.1.81740 WP_000005212.1.81758 WP_000005212.1.81800 WP_000005212.1.81810 WP_000005212.1.81812 WP_000005212.1.81831 WP_000005212.1.81861 WP_000005212.1.81870 WP_000005212.1.81897 WP_000005212.1.81903 WP_000005212.1.81905 WP_000005212.1.81906 WP_000005212.1.81919 WP_000005212.1.81944 WP_000005212.1.81955 WP_000005212.1.81999 WP_000005212.1.82009 WP_000005212.1.82053 WP_000005212.1.82091 WP_000005212.1.8212 WP_000005212.1.82121 WP_000005212.1.82219 WP_000005212.1.82247 WP_000005212.1.82259 WP_000005212.1.82278 WP_000005212.1.82340 WP_000005212.1.82354 WP_000005212.1.82358 WP_000005212.1.82368 WP_000005212.1.82447 WP_000005212.1.8246 WP_000005212.1.82467 WP_000005212.1.82548 WP_000005212.1.82612 WP_000005212.1.8265 WP_000005212.1.82709 WP_000005212.1.82724 WP_000005212.1.82796 WP_000005212.1.8280 WP_000005212.1.82802 WP_000005212.1.82829 WP_000005212.1.82862 WP_000005212.1.8289 WP_000005212.1.82976 WP_000005212.1.83066 WP_000005212.1.83088 WP_000005212.1.83152 WP_000005212.1.83153 WP_000005212.1.83185 WP_000005212.1.83193 WP_000005212.1.83234 WP_000005212.1.83316 WP_000005212.1.83352 WP_000005212.1.83372 WP_000005212.1.83418 WP_000005212.1.83476 WP_000005212.1.83484 WP_000005212.1.83508 WP_000005212.1.83517 WP_000005212.1.83593 WP_000005212.1.83624 WP_000005212.1.83646 WP_000005212.1.83653 WP_000005212.1.83676 WP_000005212.1.83720 WP_000005212.1.83763 WP_000005212.1.83769 WP_000005212.1.83770 WP_000005212.1.83775 WP_000005212.1.83804 WP_000005212.1.8383 WP_000005212.1.83864 WP_000005212.1.83865 WP_000005212.1.83868 WP_000005212.1.83881 WP_000005212.1.83905 WP_000005212.1.83912 WP_000005212.1.83919 WP_000005212.1.83928 WP_000005212.1.83955 WP_000005212.1.83984 WP_000005212.1.84010 WP_000005212.1.84049 WP_000005212.1.84064 WP_000005212.1.84144 WP_000005212.1.84163 WP_000005212.1.84293 WP_000005212.1.84342 WP_000005212.1.84414 WP_000005212.1.84442 WP_000005212.1.84445 WP_000005212.1.84451 WP_000005212.1.84508 WP_000005212.1.84509 WP_000005212.1.84563 WP_000005212.1.84578 WP_000005212.1.84625 WP_000005212.1.84638 WP_000005212.1.8468 WP_000005212.1.84682 WP_000005212.1.8475 WP_000005212.1.84752 WP_000005212.1.84757 WP_000005212.1.84761 WP_000005212.1.84815 WP_000005212.1.84889 WP_000005212.1.84903 WP_000005212.1.84907 WP_000005212.1.84922 WP_000005212.1.8493 WP_000005212.1.84943 WP_000005212.1.85022 WP_000005212.1.85047 WP_000005212.1.85056 WP_000005212.1.85081 WP_000005212.1.85099 WP_000005212.1.85113 WP_000005212.1.85132 WP_000005212.1.85135 WP_000005212.1.85144 WP_000005212.1.85151 WP_000005212.1.85160 WP_000005212.1.85213 WP_000005212.1.85226 WP_000005212.1.85235 WP_000005212.1.85238 WP_000005212.1.85292 WP_000005212.1.85302 WP_000005212.1.85351 WP_000005212.1.85374 WP_000005212.1.85383 WP_000005212.1.85395 WP_000005212.1.85404 WP_000005212.1.85445 WP_000005212.1.85462 WP_000005212.1.85471 WP_000005212.1.85474 WP_000005212.1.85492 WP_000005212.1.85506 WP_000005212.1.8551 WP_000005212.1.85515 WP_000005212.1.85519 WP_000005212.1.85547 WP_000005212.1.85586 WP_000005212.1.85596 WP_000005212.1.85649 WP_000005212.1.8572 WP_000005212.1.85758 WP_000005212.1.8576 WP_000005212.1.85795 WP_000005212.1.85796 WP_000005212.1.85816 WP_000005212.1.85834 WP_000005212.1.85873 WP_000005212.1.85927 WP_000005212.1.85950 WP_000005212.1.85989 WP_000005212.1.85993 WP_000005212.1.86018 WP_000005212.1.86072 WP_000005212.1.8609 WP_000005212.1.86123 WP_000005212.1.86144 WP_000005212.1.86154 WP_000005212.1.86158 WP_000005212.1.8617 WP_000005212.1.86188 WP_000005212.1.86207 WP_000005212.1.86248 WP_000005212.1.8627 WP_000005212.1.86270 WP_000005212.1.86304 WP_000005212.1.86344 WP_000005212.1.86367 WP_000005212.1.86378 WP_000005212.1.8643 WP_000005212.1.86439 WP_000005212.1.86482 WP_000005212.1.86508 WP_000005212.1.86523 WP_000005212.1.86526 WP_000005212.1.86542 WP_000005212.1.86606 WP_000005212.1.86628 WP_000005212.1.86706 WP_000005212.1.86792 WP_000005212.1.8681 WP_000005212.1.86838 WP_000005212.1.86881 WP_000005212.1.86910 WP_000005212.1.86911 WP_000005212.1.86940 WP_000005212.1.86942 WP_000005212.1.86961 WP_000005212.1.86977 WP_000005212.1.87021 WP_000005212.1.87042 WP_000005212.1.87057 WP_000005212.1.87072 WP_000005212.1.87090 WP_000005212.1.87119 WP_000005212.1.8712 WP_000005212.1.87122 WP_000005212.1.87141 WP_000005212.1.87175 WP_000005212.1.87194 WP_000005212.1.8720 WP_000005212.1.87260 WP_000005212.1.87261 WP_000005212.1.87264 WP_000005212.1.87272 WP_000005212.1.87285 WP_000005212.1.87290 WP_000005212.1.8731 WP_000005212.1.87396 WP_000005212.1.87457 WP_000005212.1.87461 WP_000005212.1.87466 WP_000005212.1.875 WP_000005212.1.87508 WP_000005212.1.87515 WP_000005212.1.8753 WP_000005212.1.87543 WP_000005212.1.87601 WP_000005212.1.87703 WP_000005212.1.87710 WP_000005212.1.87718 WP_000005212.1.87748 WP_000005212.1.87764 WP_000005212.1.87782 WP_000005212.1.8779 WP_000005212.1.87808 WP_000005212.1.87828 WP_000005212.1.87838 WP_000005212.1.87843 WP_000005212.1.87879 WP_000005212.1.8791 WP_000005212.1.87912 WP_000005212.1.87943 WP_000005212.1.87963 WP_000005212.1.87964 WP_000005212.1.87972 WP_000005212.1.87995 WP_000005212.1.88013 WP_000005212.1.88032 WP_000005212.1.88061 WP_000005212.1.88114 WP_000005212.1.88150 WP_000005212.1.88240 WP_000005212.1.88270 WP_000005212.1.88317 WP_000005212.1.88319 WP_000005212.1.88351 WP_000005212.1.88367 WP_000005212.1.88371 WP_000005212.1.88373 WP_000005212.1.88380 WP_000005212.1.88395 WP_000005212.1.88473 WP_000005212.1.88480 WP_000005212.1.88490 WP_000005212.1.88498 WP_000005212.1.88518 WP_000005212.1.88536 WP_000005212.1.88555 WP_000005212.1.88558 WP_000005212.1.88560 WP_000005212.1.8857 WP_000005212.1.88580 WP_000005212.1.88599 WP_000005212.1.88623 WP_000005212.1.88636 WP_000005212.1.88671 WP_000005212.1.88694 WP_000005212.1.8872 WP_000005212.1.88739 WP_000005212.1.88753 WP_000005212.1.88761 WP_000005212.1.88856 WP_000005212.1.88859 WP_000005212.1.8886 WP_000005212.1.8888 WP_000005212.1.88897 WP_000005212.1.88922 WP_000005212.1.88934 WP_000005212.1.88987 WP_000005212.1.8899 WP_000005212.1.8900 WP_000005212.1.89070 WP_000005212.1.89086 WP_000005212.1.8913 WP_000005212.1.89133 WP_000005212.1.89181 WP_000005212.1.89194 WP_000005212.1.89195 WP_000005212.1.89204 WP_000005212.1.89235 WP_000005212.1.8924 WP_000005212.1.89258 WP_000005212.1.89284 WP_000005212.1.8929 WP_000005212.1.89537 WP_000005212.1.89544 WP_000005212.1.89545 WP_000005212.1.89559 WP_000005212.1.89594 WP_000005212.1.89655 WP_000005212.1.89672 WP_000005212.1.89678 WP_000005212.1.897 WP_000005212.1.89715 WP_000005212.1.89726 WP_000005212.1.89730 WP_000005212.1.89738 WP_000005212.1.89754 WP_000005212.1.89857 WP_000005212.1.89883 WP_000005212.1.89933 WP_000005212.1.89935 WP_000005212.1.89960 WP_000005212.1.90005 WP_000005212.1.90018 WP_000005212.1.90038 WP_000005212.1.90046 WP_000005212.1.90055 WP_000005212.1.90091 WP_000005212.1.90112 WP_000005212.1.90148 WP_000005212.1.90161 WP_000005212.1.90180 WP_000005212.1.90215 WP_000005212.1.9022 WP_000005212.1.90232 WP_000005212.1.90243 WP_000005212.1.90253 WP_000005212.1.90276 WP_000005212.1.9030 WP_000005212.1.90331 WP_000005212.1.90432 WP_000005212.1.90473 WP_000005212.1.90517 WP_000005212.1.90544 WP_000005212.1.9055 WP_000005212.1.90554 WP_000005212.1.90604 WP_000005212.1.90647 WP_000005212.1.90660 WP_000005212.1.90683 WP_000005212.1.9071 WP_000005212.1.90717 WP_000005212.1.90726 WP_000005212.1.90728 WP_000005212.1.90738 WP_000005212.1.90745 WP_000005212.1.90801 WP_000005212.1.90804 WP_000005212.1.90861 WP_000005212.1.90896 WP_000005212.1.90903 WP_000005212.1.90923 WP_000005212.1.9100 WP_000005212.1.91011 WP_000005212.1.91054 WP_000005212.1.91087 WP_000005212.1.91124 WP_000005212.1.91126 WP_000005212.1.9114 WP_000005212.1.91158 WP_000005212.1.91177 WP_000005212.1.912 WP_000005212.1.91233 WP_000005212.1.91246 WP_000005212.1.91252 WP_000005212.1.91258 WP_000005212.1.91279 WP_000005212.1.91300 WP_000005212.1.91310 WP_000005212.1.91332 WP_000005212.1.91346 WP_000005212.1.91357 WP_000005212.1.91364 WP_000005212.1.91365 WP_000005212.1.91382 WP_000005212.1.9140 WP_000005212.1.91420 WP_000005212.1.91427 WP_000005212.1.91487 WP_000005212.1.91500 WP_000005212.1.91559 WP_000005212.1.91573 WP_000005212.1.91581 WP_000005212.1.91587 WP_000005212.1.91639 WP_000005212.1.91749 WP_000005212.1.91771 WP_000005212.1.91791 WP_000005212.1.91800 WP_000005212.1.91816 WP_000005212.1.91829 WP_000005212.1.91895 WP_000005212.1.91928 WP_000005212.1.91950 WP_000005212.1.92 WP_000005212.1.92080 WP_000005212.1.92133 WP_000005212.1.92143 WP_000005212.1.92164 WP_000005212.1.92169 WP_000005212.1.92173 WP_000005212.1.92185 WP_000005212.1.92196 WP_000005212.1.92227 WP_000005212.1.9224 WP_000005212.1.92253 WP_000005212.1.92254 WP_000005212.1.92297 WP_000005212.1.923 WP_000005212.1.9234 WP_000005212.1.9239 WP_000005212.1.92398 WP_000005212.1.92415 WP_000005212.1.92436 WP_000005212.1.92442 WP_000005212.1.92488 WP_000005212.1.92497 WP_000005212.1.92500 WP_000005212.1.92520 WP_000005212.1.92534 WP_000005212.1.92541 WP_000005212.1.92544 WP_000005212.1.92565 WP_000005212.1.92607 WP_000005212.1.92679 WP_000005212.1.92691 WP_000005212.1.92723 WP_000005212.1.92735 WP_000005212.1.92741 WP_000005212.1.92773 WP_000005212.1.92778 WP_000005212.1.92789 WP_000005212.1.92805 WP_000005212.1.92848 WP_000005212.1.92862 WP_000005212.1.92864 WP_000005212.1.9293 WP_000005212.1.92937 WP_000005212.1.92950 WP_000005212.1.92960 WP_000005212.1.9298 WP_000005212.1.93010 WP_000005212.1.93041 WP_000005212.1.9305 WP_000005212.1.93068 WP_000005212.1.93074 WP_000005212.1.93125 WP_000005212.1.93141 WP_000005212.1.93163 WP_000005212.1.93176 WP_000005212.1.93191 WP_000005212.1.93207 WP_000005212.1.93211 WP_000005212.1.93224 WP_000005212.1.93237 WP_000005212.1.93296 WP_000005212.1.93300 WP_000005212.1.93310 WP_000005212.1.93336 WP_000005212.1.93416 WP_000005212.1.93444 WP_000005212.1.93492 WP_000005212.1.93514 WP_000005212.1.9352 WP_000005212.1.9354 WP_000005212.1.9358 WP_000005212.1.93590 WP_000005212.1.93613 WP_000005212.1.93658 WP_000005212.1.93678 WP_000005212.1.93710 WP_000005212.1.93722 WP_000005212.1.93736 WP_000005212.1.93738 WP_000005212.1.93769 WP_000005212.1.93787 WP_000005212.1.9387 WP_000005212.1.93882 WP_000005212.1.93883 WP_000005212.1.93891 WP_000005212.1.93976 WP_000005212.1.9398 WP_000005212.1.93981 WP_000005212.1.94074 WP_000005212.1.9408 WP_000005212.1.94082 WP_000005212.1.94087 WP_000005212.1.94096 WP_000005212.1.9411 WP_000005212.1.94119 WP_000005212.1.94165 WP_000005212.1.94209 WP_000005212.1.94293 WP_000005212.1.94294 WP_000005212.1.94335 WP_000005212.1.94340 WP_000005212.1.9437 WP_000005212.1.94374 WP_000005212.1.94375 WP_000005212.1.94376 WP_000005212.1.94389 WP_000005212.1.94414 WP_000005212.1.94530 WP_000005212.1.94550 WP_000005212.1.94576 WP_000005212.1.9464 WP_000005212.1.94684 WP_000005212.1.94688 WP_000005212.1.94733 WP_000005212.1.94741 WP_000005212.1.94789 WP_000005212.1.94797 WP_000005212.1.94844 WP_000005212.1.9485 WP_000005212.1.94857 WP_000005212.1.94866 WP_000005212.1.9497 WP_000005212.1.94980 WP_000005212.1.94989 WP_000005212.1.94999 WP_000005212.1.95038 WP_000005212.1.95075 WP_000005212.1.95077 WP_000005212.1.9510 WP_000005212.1.95120 WP_000005212.1.95210 WP_000005212.1.95318 WP_000005212.1.95327 WP_000005212.1.95342 WP_000005212.1.95361 WP_000005212.1.95372 WP_000005212.1.9538 WP_000005212.1.9544 WP_000005212.1.95537 WP_000005212.1.95550 WP_000005212.1.9557 WP_000005212.1.95571 WP_000005212.1.95581 WP_000005212.1.95603 WP_000005212.1.95639 WP_000005212.1.95681 WP_000005212.1.95699 WP_000005212.1.95704 WP_000005212.1.95713 WP_000005212.1.95714 WP_000005212.1.95737 WP_000005212.1.95760 WP_000005212.1.95806 WP_000005212.1.95877 WP_000005212.1.95914 WP_000005212.1.95918 WP_000005212.1.95986 WP_000005212.1.95997 WP_000005212.1.96014 WP_000005212.1.96030 WP_000005212.1.96056 WP_000005212.1.96057 WP_000005212.1.96067 WP_000005212.1.96075 WP_000005212.1.96148 WP_000005212.1.96165 WP_000005212.1.9617 WP_000005212.1.96228 WP_000005212.1.96255 WP_000005212.1.96280 WP_000005212.1.96283 WP_000005212.1.96297 WP_000005212.1.96312 WP_000005212.1.96314 WP_000005212.1.96322 WP_000005212.1.96334 WP_000005212.1.96362 WP_000005212.1.96433 WP_000005212.1.96472 WP_000005212.1.96474 WP_000005212.1.9650 WP_000005212.1.96535 WP_000005212.1.96538 WP_000005212.1.96548 WP_000005212.1.96554 WP_000005212.1.96566 WP_000005212.1.96591 WP_000005212.1.96603 WP_000005212.1.96628 WP_000005212.1.96634 WP_000005212.1.96654 WP_000005212.1.96663 WP_000005212.1.96678 WP_000005212.1.96699 WP_000005212.1.96705 WP_000005212.1.9675 WP_000005212.1.96780 WP_000005212.1.96854 WP_000005212.1.96855 WP_000005212.1.96859 WP_000005212.1.96866 WP_000005212.1.96882 WP_000005212.1.96922 WP_000005212.1.96928 WP_000005212.1.96969 WP_000005212.1.96970 WP_000005212.1.96985 WP_000005212.1.96997 WP_000005212.1.97000 WP_000005212.1.97004 WP_000005212.1.97014 WP_000005212.1.97017 WP_000005212.1.97019 WP_000005212.1.97029 WP_000005212.1.97034 WP_000005212.1.97077 WP_000005212.1.97141 WP_000005212.1.97161 WP_000005212.1.97164 WP_000005212.1.97205 WP_000005212.1.97228 WP_000005212.1.97241 WP_000005212.1.97293 WP_000005212.1.97311 WP_000005212.1.97312 WP_000005212.1.97336 WP_000005212.1.97348 WP_000005212.1.97352 WP_000005212.1.97355 WP_000005212.1.97367 WP_000005212.1.9737 WP_000005212.1.97392 WP_000005212.1.97427 WP_000005212.1.9743 WP_000005212.1.97444 WP_000005212.1.97450 WP_000005212.1.97456 WP_000005212.1.97466 WP_000005212.1.97468 WP_000005212.1.97494 WP_000005212.1.97530 WP_000005212.1.97531 WP_000005212.1.97537 WP_000005212.1.97576 WP_000005212.1.97585 WP_000005212.1.97590 WP_000005212.1.97664 WP_000005212.1.97687 WP_000005212.1.97696 WP_000005212.1.97699 WP_000005212.1.97720 WP_000005212.1.97729 WP_000005212.1.97744 WP_000005212.1.97746 WP_000005212.1.97762 WP_000005212.1.9788 WP_000005212.1.97935 WP_000005212.1.97955 WP_000005212.1.97967 WP_000005212.1.97974 WP_000005212.1.97997 WP_000005212.1.98054 WP_000005212.1.98058 WP_000005212.1.98073 WP_000005212.1.98131 WP_000005212.1.98161 WP_000005212.1.98174 WP_000005212.1.98179 WP_000005212.1.98191 WP_000005212.1.98195 WP_000005212.1.98233 WP_000005212.1.98248 WP_000005212.1.98249 WP_000005212.1.98281 WP_000005212.1.98295 WP_000005212.1.98328 WP_000005212.1.98352 WP_000005212.1.98353 WP_000005212.1.98360 WP_000005212.1.98366 WP_000005212.1.98387 WP_000005212.1.98409 WP_000005212.1.98425 WP_000005212.1.98497 WP_000005212.1.98585 WP_000005212.1.98609 WP_000005212.1.98659 WP_000005212.1.98667 WP_000005212.1.9872 WP_000005212.1.98723 WP_000005212.1.98730 WP_000005212.1.98734 WP_000005212.1.98741 WP_000005212.1.98750 WP_000005212.1.98786 WP_000005212.1.98797 WP_000005212.1.98821 WP_000005212.1.98842 WP_000005212.1.98880 WP_000005212.1.98883 WP_000005212.1.98894 WP_000005212.1.98978 WP_000005212.1.98985 WP_000005212.1.9903 WP_000005212.1.9910 WP_000005212.1.9912 WP_000005212.1.99136 WP_000005212.1.99207 WP_000005212.1.99217 WP_000005212.1.99237 WP_000005212.1.99283 WP_000005212.1.99308 WP_000005212.1.99311 WP_000005212.1.99414 WP_000005212.1.99418 WP_000005212.1.99509 WP_000005212.1.99523 WP_000005212.1.9965 WP_000005212.1.99683 WP_000005212.1.99700 WP_000005212.1.99830 WP_000005212.1.99849 WP_000005212.1.99859 WP_000005212.1.99884 WP_000005212.1.99901 WP_000005212.1.99934 WP_000005212.1.99954 WP_000005212.1.99955 WP_000005212.1.99963 WP_000005212.1.99984 WP_000005212.1.99999 gi|385781688|ref|YP_005757859.1| gi|269203087|ref|YP_003282356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]