SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9C8H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9C8H1
Domain Number 1 Region: 1185-1395
Classification Level Classification E-value
Superfamily HCP-like 0.000000126
Family HCP-like 0.023
Further Details:      
 
Domain Number 2 Region: 884-1040
Classification Level Classification E-value
Superfamily HCP-like 0.0000192
Family HCP-like 0.028
Further Details:      
 
Weak hits

Sequence:  A0A1Q9C8H1
Domain Number - Region: 1120-1220
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0127
Family Pseudo ankyrin repeat 0.033
Further Details:      
 
Domain Number - Region: 740-864
Classification Level Classification E-value
Superfamily HCP-like 0.0162
Family HCP-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9C8H1
Sequence length 1767
Comment (tr|A0A1Q9C8H1|A0A1Q9C8H1_SYMMI) Pentatricopeptide repeat-containing protein, chloroplastic {ECO:0000313|EMBL:OLP79167.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene40583 OC=Symbiodinium.
Sequence
MASERGADSEALPEVYEDSAVTSALPTHREAPVQEEARGEDEVVLPAAVKRILQLRREED
DRSDDDLSGEAAGAAGRPQPPEGWSAALRQFSEEVRHISKDAGRTQSQLEVRTFFDLQGY
NLESFASKTGPEPGSLLLMYMFYSRIFEKVDRFSFLDLARASWKKGQLEHIMKLKRFLLR
YDPPGVGLEVEADDQVTVQHKNLPAKSEVSTSKEVHALVDQLIEAEPALLTRKRHREGLI
QLLGRLYQVETAEEERPSEPQDAAEDPKDRDELHGQSVVLTGLSGSQQAFNGEVAVVVKA
KGDKQKYEVEVKGQVVKVKGKEHLLQVSSKGPLAAGAFVAIRGLRNHVELNGCVARVAEC
HEESQRYEVRALDSGQLFRVKKDNVILIETTPAVLAASAAMKENREPNTSPRKEGTLPAT
GETDDVLEVGSTVELVGLKTAQAYNGQQAEVLSVDQVRGRPWLVSQKNSPMCSAFNLQVG
KQKGVEVQLFAPINFDDRLLGFRAILEWAKDFKMMPVRVPRRQLERIFVTCHAGNMPSHE
KFASKITYPEFLTLVTFCGNTGEPMDLSRVDGSRFRENASKYFEAMKCHVVRSLLPAVIG
SSMVSRLKPHQRLLSRSRPRPLRVHITLSLLSLRALLLDSIMAVLSSCYSFFTSSTTLNI
TLRTMFLAALTSMLFNAIDLRLPVPAAVEELTVVVVLLALELGLSRRQDSTTKKSKPCPG
ERRVYEDVTGLAGRLQAAAKAGDTDAAEALMERILGEGTKPSLVCYGALISAFAKAGDVK
RAEYWLEALEASGVGSPNGICLNMLISACAKANAVDRAEYWLVKMPSLGLSPDVMSYNAV
IDACARTGDVVRAERWLEKMKASGTTPNVVSYSSVLHACARSCDASLAERWLERMSKEGA
EPNAICYNAVINAWCKEGNTRRAAHWLEQMSQRGVQPTVNSYSTIIDKLAKAGDIDGAET
WLMRMAEAGVEADAVSYNMLFSACSKMGDSVRAGKLFDQMMQRKVTPNTICFNLIINTHS
RQGDFYAVLRRLRQMREQGIQADRVSFNTSLKAFSRCSDCKAVEKLLEEMQSAGVKPDVG
AYNTFIAVCMRAKDASKAEEWLCRMTSAGVQADAVSYCTMIDAFAQSGDLHRAEKWLEKM
ERSGLQVGATTYGLLISTVAKMGDVGRVERIFERMDRANVEVNGSTYNALISACARKGDV
DRAEFWLKKLLKSNAQADVASYSSVIHACAKANSLRRAEAWIEQMEHDGIPANVVTYNSV
INACARCGDATRAEYWFQKMTAQGVQPGVLTFNSLVNACAKALDVDRAEKWLQEMPQHNV
QPDDVSYSTVIHACGTAQEPERAEQWMKLMISSLSSQGEKPGSFCYNSIAQAWVRAGDVD
RAMHWLSEAERLGVEVSSASLNGVVSALTRARRHSEVELWSSKVRKGDRGDRGERRYPQR
LEQVKRLATFLCLNNSKKVKLHLHNAYRDTHFWKLSDGADFQKEARAAEMRSRPHYEVGC
LEIDTEITAAKKFLEKFTWTNPDNLWEEFEAPFLDMGASVLNQKSKRFKLQIINRALVLA
KLSIQLSNTGPLRLPWKDCMVGPGQHVNVLIDTAPIECGEWRGAIRVLGSWAGFFGNVEG
EVCIPTYFRVQTQQKDKDAGRTLPVHAPRPFRPGSANRIWIDPATLHPQQLRSPTPLRLR
PASSSASSAKQESQQGYRPGSSRTGVSTAVPSSRPLSALGPPSSRGCCSASAVPSSRSQA
GRHVAAPLPPSAPQVDHSITFRKGDIR
Download sequence
Identical sequences A0A1Q9C8H1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]