SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9CAQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9CAQ4
Domain Number 1 Region: 11-112
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.27e-27
Family Chaperone J-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 796-976,1012-1068
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.83e-25
Family Ankyrin repeat 0.0075
Further Details:      
 
Domain Number 3 Region: 134-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000317
Family PDI-like 0.01
Further Details:      
 
Weak hits

Sequence:  A0A1Q9CAQ4
Domain Number - Region: 1247-1284
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0118
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0092
Further Details:      
 
Domain Number - Region: 403-477
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0189
Family PDI-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9CAQ4
Sequence length 1597
Comment (tr|A0A1Q9CAQ4|A0A1Q9CAQ4_SYMMI) DnaJ-like subfamily B member 11 {ECO:0000313|EMBL:OLP80009.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene39627 OC=Symbiodinium.
Sequence
VLTSLPLIAAKGADYYAILGIPRNADQAAIKKAYRGKSLEYHPDKCADDKEQCQTKFIEV
SSAYEVLSDAEKRKVYDQHGEEGLKEGHQSDEQAKAMFRQFFGREPDGNVRIVRRGGQMM
FMEEGEPGPKEDIYGNTNVTELTSDLYGSQINDRIEPWFVQFYKPNNDESREVRGEYIKF
ADTFKDFLNIGAVNCRQQRDVCSKASINEYPAFRWFGEDKGTPPEIFSEGTPSAKNLGKW
ASAMMPDYTTVLQDKHELRKWLDNVKGPHILLFTDKMSSPPMWKGLSREFNGRASLATVP
RCDRTGVFKTPLQREYDVRIPQVVRIDPLDEIGKVTEKFSLTLKKESLNLWFMKAIALGK
KAGPQATFKELSRDRIEAGDCGPTDSQFCFLWLKAGADPAVEEATRQLAQKYRRDPIKMM
WANVELNPSLLDAFDLHESDASDFFVALRSKRSRFKVHTGELRFEELDGFVDGVLNGGPL
PGKLKVPKIVRKETVLTAFDSNKEFDLGVKSAPMSCIAAKPLSALELYARALPHDADVAP
LHFPMYTVSVELLLKMTAVEPHEKLKARGELVVFDSDGSGKTAAFVSHQWIAKEHPDPDF
KQMAVLQAALRRLLGGKGSVPLDPITETFVASAKPLPLKDLQKHEVTFNLFGRCHLFIAL
CPVLDCPEESKVLTSATWSRRGWCRVERAARELSPNSTWVLIQSDSSIEAVGTVASFACG
SVGEGEFTIGADRHVLAPVMQQIILRKLMHCLRRRDLPAFRRYFNLQGVHLRGLEIELLP
GFLPSSSSEGAGDDVLVEFLHQNGFRNVDEKDSAGWRPLHYAAVAGNTKVLRQMLEKKVD
VNQLTSKDEPQLGFPLWMSALSFAVFYKQHEAIQLLLDAKALLKGGIASAMDSVSSDSAE
CVRLLCAAGSHPLSKNLLGFTALQTAAAFAATMSVEEMVASHPVSPLALSQALFHAASFR
GGTAELIQHLIELRADPDFQFDGRSDLRPVGRVFYAAKSTQHWLGRHTALSAFAYHLNGS
TPLMQAIRSTQYEAAATLIAAGARLDLRNCRKWQAADFAKRQAIPEFLKLGLSTQLSQRH
QFHQKGAGEQKPRSSSPEGDLRTAPYHTPSAAWHRGTALAEAAWKWKSSASLVRLPIRWC
PSGPAANASKPPSRRWARPELVHVYVGSARLAVRPGEGNYSIEVKDAGEGGEPVRVGFAV
RALGPKKGEQGEAPPLERPKVRSRGASNALPMKEEEEKRFLSQTAVAKEYLEAHELLPFV
RALLQTVIRDRPLDPYSFIAEQFRIAAAAFKPAQPAPGFAAAADAFVDPELEKETGPDPP
KLPKSDEPVGPSSELPTAVPGTTCRPQREEEEPQDGAAVEGLRLRIRDVLGQVQAPSASP
LQTTVSALDANASPPADGEAALAKMTTEAPGDVAKAEVVAGNLDALSVAESHEEDTKLAK
AVFATRPLIELGLQNYCEQHADLAEYSWTALSQAFLRDHVFNLQKKPQWWINDMLNYLNH
HVGWDVQPNSPQFQTCLWEVYGRFSEKHHGIGDVGKGFVVTGTNPLQTAAAVILISALRY
QSCLGQMQIAISPPDVTGQPPPSLYIDQSGRLQDVEV
Download sequence
Identical sequences A0A1Q9CAQ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]