SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9CDQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9CDQ6
Domain Number 1 Region: 494-758
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 2.3e-50
Family Guanido kinase catalytic domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 883-1106
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 5.33e-32
Family Guanido kinase catalytic domain 0.0000785
Further Details:      
 
Domain Number 3 Region: 391-468
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 3.66e-17
Family Guanido kinase N-terminal domain 0.00035
Further Details:      
 
Domain Number 4 Region: 778-853
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 0.00000085
Family Guanido kinase N-terminal domain 0.0019
Further Details:      
 
Domain Number 5 Region: 319-362
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000235
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9CDQ6
Sequence length 1144
Comment (tr|A0A1Q9CDQ6|A0A1Q9CDQ6_SYMMI) Creatine kinase, flagellar {ECO:0000313|EMBL:OLP81074.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene38426 OC=Symbiodinium.
Sequence
MAAQRRGGGLLWAALLSGLALNVLDLRRPAFLAVETHQKPVQSRRSFAWAVGAGLLSEPA
WAEEEAAPKKKKERPPETLIAEGLESKAIPLNGRWSIVFGKKIAGKPVYKKDGESYFLMT
NDCGQLQIDTEKKATCDGSIGIQKESGWVIDGKAAANFKVRPETKEDANKSQGISASKLN
EIVSEDLAKFERQSSVNTFRGTMDDDDEVLEVDDLPANTFLSLRYGDIRKQAPFRAGESF
AFPPSGKQPKAFTVDVFQKVASSQVSLAGISALGGSLNNVEIETLDIGSAPLKASFEASL
RSFDHQEKSGASRGRNAAERAKQYMEQRGVQHFLQEMFTQLLERKPEDYLGFLADFIEQK
QDEADHADRNEIDFSSEPGLGENPLPGFAAFPLPDLGKHNSIATEVLRAQPEIEQLADLR
TSMGVSLAQCIKPGVDCPGHPMVKVAGAFAGDAECYSMFHQFFDPLVASLSLKGSVRSGD
GATHPLDGDVSKISSDQIDPSGSYVVYAVLEARRNVEGIRMPVSCSKEERREVEKLLSSA
RLRGTYLPLAGSKSWPKRLGGMAAFQEERLRKVGMLLTEPDSKLKLAAGFGRHWPDARGV
MVCDAPGVFVWCNEEDHYRFFARQEGSEIKELYERMAKTMSAVSEAATMAGRAFASSSKL
GWLTTCPSRVGAALRVTLTLRIPLLAKAVELPALCECLHLHCDSSSSAISGNLWQIHSLS
SLGVSEVEVMNEMIQGCKLLVGLEQRLERKEPIFDALPGLGRELPFSPLPCQGPCPEAMP
DLAGCRSLVAASLRVNPKLYLQYRSLATSSGTHLGVCLRPAFDRDVGRQKTASGLVAGDE
ECLDTFRDLFVAVHGQLQALQASWEPPRGSWTSVELTSSCQWVKIEMRRNVSGLRFAPSC
STDERREVERLLVRCMENQKAVTGQYYPLAFSQSYPLMPNGINQQEERHLVRLGKLFPAP
HALGELSSGVGREWPDARGAFLSDGTADDGCETLAWVNQADHLRLRCFVPGGDMQLAYRK
VQGMADNIETELNSLCSRGFSRHAKFGYVTVDSLHLGSGMQLTAAMQLPELSQLEDFPKL
CARLKLTQTWHDDGYELSSYPAPELKAEDLLARTLQSLRILAGLDQSLADGQNVQPDLEA
LGVI
Download sequence
Identical sequences A0A1Q9CDQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]