SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9CP91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Q9CP91
Domain Number - Region: 166-198,237-248
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0628
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9CP91
Sequence length 709
Comment (tr|A0A1Q9CP91|A0A1Q9CP91_SYMMI) Uncharacterized protein {ECO:0000313|EMBL:OLP84734.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene34379 OC=Symbiodinium.
Sequence
MTTLIPAHFVWMRDGQYGKHRRGRLVKKAPKIGADALRASRPWEHTTQEVAARTGWAQHL
VPGETVELSQFQWRRPQRLRRLQLSDETQLAIRQLLVERRLETAQEGEHSEWFTSHVPTA
PVSGTWFHVLAYPLLGDVTKVLLRPVMKCWTAAQRESVARATRWLGETLISQCAKAGQWE
LVEVLVENGVPLPDLSREFSQVCGPSVPCQRQWHKDWRQALGTQGPTPILELAAASKDGP
RVLESLLQRASDKHRDKGCAGPLRLPDLLGGLGGRPQPLLLRAAEAKRWNVVHVLLTSSV
PVAAATLLSSPHAATCPTALVHLAEERALEEASPLSAATGSPEEDQLALFFRRRHASVVL
LNEEVPGYQSQASGSGGIYLEKADGQIRVWHELLHIGMSGGQSQSSEVAFVKLQDGEWEE
LLSIEKAALSLSLSSRPAAKTPDAKVGVCWLAVLCPASYLQASKEGLLLVPPQRIPTPCC
VQSVKLCVSTQSACCKEPMKDVPVYLDGQCIGRSNEEGLVEVFAKPGRRTLQSPCAGAEA
VEVTLTGEGKSGKHDEQHVVLLCGGSVYFFLQAQDSSSEWKLKMTTDLNQIPSDASDFRG
KVCFDDDHPFQVIRSCFHPMIVPGGKPCPALFHSLRPEALSGARFEFSEEGRSRLAGDKC
KVSDLIGAVVTLGTFFDTVDTLAKGVQPRSRKMADFAFAPRRRGLGQRA
Download sequence
Identical sequences A0A1Q9CP91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]