SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9CQC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9CQC2
Domain Number 1 Region: 310-478
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.88e-20
Family Nucleotide and nucleoside kinases 0.0018
Further Details:      
 
Domain Number 2 Region: 125-285
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-16
Family Nucleotide and nucleoside kinases 0.00046
Further Details:      
 
Domain Number 3 Region: 81-120
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000017
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9CQC2
Sequence length 522
Comment (tr|A0A1Q9CQC2|A0A1Q9CQC2_SYMMI) Adenylate kinase 8 {ECO:0000313|EMBL:OLP85095.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene33983 OC=Symbiodinium.
Sequence
MHARSIPGDLLAKGLGHSLAAVSYAALDEVFRVAVSPYACPRATVVDCTWILQIPADMVT
PVQTWGALGNMVPEQKEFGAETNAYLESYEVYDLFAHLLRQVLVERPENPIKFLQECLKE
QSKLCVCVMGPPGVNRSKYCQQLATDFKVKHIHVGKLLRGKKELKNILDSGELVGDDMVV
DIVKEELRKAKHTGWVLDGFPRTKVQAQSLAAASKELGTSLDSVLLLDSSEDLARHNFAA
KVDAADPAVKREVAEMRLQQYKRHVLTISEFFQNSVRRIEIHGGEDEQKSIYSTICSNVQ
YRAYSNAPLRMQRVCILGPCGSGRTTQCQLLAKRLGVVHVDLATLLREKQEAEGQEVDEV
PPEYLSDEEACALIGARLRKTDCVRKGWVLDGFPKTQAQAEFLRQAHLWPSRIIQLQVAD
AVVETRVSSRRLDPVTGTAHYSNPNSVAVRQRLVRCKHDEGEKVKERVNMFLDNVSLVSD
SWKRVFTTVLADGQPEDVAAGVYEKVANPLPSELAQDPNSGL
Download sequence
Identical sequences A0A1Q9CQC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]