SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9CYF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Q9CYF3
Domain Number - Region: 113-152
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000207
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0099
Further Details:      
 
Domain Number - Region: 1498-1565
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0458
Family Mitotic arrest deficient-like 1, Mad1 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9CYF3
Sequence length 2369
Comment (tr|A0A1Q9CYF3|A0A1Q9CYF3_SYMMI) Sperm acrosomal protein FSA-ACR.1 {ECO:0000313|EMBL:OLP87946.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene30808 OC=Symbiodinium.
Sequence
MEVNLLSKSGIPNDAILSIRAGSMRRQAQLDSGRLPFKFPVELMKENPLRVDILQQVGTG
HLVTKPGESQRYKVTFGDSEAEVELEVKKADGDAVAKSSDESKRNQDPAASAKGAKEYLD
NHDVLRVVQAVLQAVIKEKPDDPYRFMAKLFMNGYIAGGAAESATQEAPKAVPAPEPVTE
AKPQETMAEAPKAEPVAEAPAPAQEAKPEEPAAEAPKAESATEAKPKKCTKGVEAPKTEE
AAAEVPKTEEPAAEAPKAEEAAGEVPKTEEPAAEAPKVEEAAAEAPKTEQPVAEPPKVEE
PAAEAPKAEEAAAEVPKTEEPAAEAPKVEEAAAEAPKTEQPAAEAPKVEEPAAAPKAEEA
AAEVPKTEEPAAEAPKVEEAAAEAPKTEQPVAEAPKVEEPAAEAPKAEEAAAEVPTTEEP
AAEAPKVEEAAAEAPKTEQPVTEAPKVEEPAAEAPKAEEAAAEVPKTEEPAAEAPKVEEA
AAEAPKTEQPAAEEPKIEEPAAEAPKAEEAAAEVPKTAEPAAEAPKVEEAAAEVPKTEEP
KAEEAVAEAPRAEEPAAEAPKAEEAAAEAPKTEEPAAEAPKAEEAAAEAPKTEEAAAEAP
KAEEAAAEAPKAEEPAAETPKAEEAAAEAPKTEEPSAEAPKTEEAAAEMPKTEEAAAEAP
NAEEAAAAVAPKTEEPAAEAPKAEEAAAEAPKAEEPAAEAPKAEEAAAEAPKAEEPAAAP
KAEEAAAEAPKAEEPAAEAPKAEEAASGAEAPKRIRDGDFVFSSMIVTRRYQKRPLHSAS
PAAAPLMRNFLCSAQFPMWGHGLLQKPALQCGTPPWARHGECAVLKAHSPSHQAGLGCPI
TLPNTAGSVLAGKAAYLLHGHGIVMVRFELAYTVLVTDTFGLSEDVLVSIRYGTTRRQAP
LESVLRPAIFYLAATPAEEGTLVFTSEALESAATPFRTYLLVWAGENVTSKIVILEIPRN
EEARLADKLFHIVDKRIRNALRRQGGHNTTAECQPTVQEGEENPRQAEDVDANAMPTPSM
RRGAMTTERVRMENREEDAARGIKEQPVDSDTPPDWGGETDEEDPPTSPTSPAKYPDTNA
KNLAGKAGGYSLGTWHEIRDHVQRSYLILWEAEFGQLGDLERSGQPVLAAGALLLMCWTM
MGIRPAKELPIPTKDSAASAKDYLEQNGLLKYVQSLLHAVIQDKPQDPLHGLKQWGSVEF
QLAFAYMIEQLTAAKSCLQVRSLCEGPFPTDQCSAPKPPHKRHAAVVLSLHDSCSESAPF
VTESLGQMLPRQPLLEAPAPEEEPPALPQHPAGQMAAAPAFSEARKEEAESSRAAPPTSV
QREAEHLVAGEAVPEQASAAKLRQSQEDFGTQAQDAEDPAAAIQRQRLEELDQRIGSKLG
MKFGPLQEQSDQGADVKQSILKALADASESGDLGMVLSAVGVDKSRSRIQALLEKSAETG
ELEAALKRTMDTKDVAVACIKIFLMCDLDKLKGHLRDVLLDANESGQVLDILAQQSGRIS
RPEKPEATEEIEKLKANLKSLLLDANESGRVLAVLQEPMSAEKAEEAGAQKALEEEMEHL
KQRMKAALFDADPSAVLQALEKTKRMGQPDAAGGPEAKTAAPALPRATHELVNAQAKMQE
GLRNGLLQQGLEKVMQKGDVKEAKDRLRETMNESAEREGLVLKADSIALEELSAIKGRMK
DVMMKAAETGTLAKELEKLLESVAAERPPGLPGQSDLEALGEKLRGVLEEASDTGKLEEA
LRLLREEQEETMKNAPKDDLEAVRSNLCTVVEAVDSGKLAAALDALRSYGEPQPSSAAAS
DQIAVIKAKFRRLLKEALESGMLAAKVPAPPQGEPPHEMEIMKAHLREVRLCNMRQSALE
INGTCITQWRWQRARERYEQCGQLAEALASARSLEGAEQRGADVEATAVKLRGVLAEAAL
CGRLEETLKALQKDDGSLAEPLPAEAAAGKAPEVAPEVNPMAWQCSPKFDQALEEMSEWF
KDAGEVESKADSSDFEHGSLLPAKNQSNQEEATMEESLQTQSSGQMEDQHAKPGAKPSSQ
DFTQAREVANHIYSTAKAVLEQSHHEFLQLLTSIDRKNPEQNEQVAHCSQSIEIMSPVST
DAGTAGTADIELQSVASDRQSEGSTSESKQWKRSIKTKRGSRSSIPCSPVSPGLVTRASC
CLYGKQEKLHEKRYDSLGSGEEKIETMDKTDKTDKTKLSFMMKDTDMISVKKVDSKPRSG
ASSVASDDCKKTSPKDVGRVRLRITPQHFSPLGTAFRDVQVDFLPMSFSIRALDFEGYAW
TAHSNTLPGCLAMDRCKYKIDPSGKDVVITLFGADETQSWKGMTRLELTRPYDFPEQTQP
GEAELKNPKVMTPTKAKSTRTPSLKNNFI
Download sequence
Identical sequences A0A1Q9CYF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]