SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9CYM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9CYM6
Domain Number 1 Region: 297-382
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 3.4e-18
Family Guanido kinase N-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 1727-1811
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 0.0000000028
Family Guanido kinase catalytic domain 0.0011
Further Details:      
 
Domain Number 3 Region: 215-253
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000118
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0045
Further Details:      
 
Domain Number 4 Region: 872-907
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000272
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  A0A1Q9CYM6
Domain Number - Region: 412-466
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 0.000336
Family Guanido kinase catalytic domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9CYM6
Sequence length 1820
Comment (tr|A0A1Q9CYM6|A0A1Q9CYM6_SYMMI) Creatine kinase, flagellar {ECO:0000313|EMBL:OLP88024.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene30705 OC=Symbiodinium.
Sequence
MSRKAFGSGVFVGSAMLRSLQLALGCVIIERTWRHHSAADEAAANSTELVNDIAESEWRE
PSAWSLSSRLRPRPWTETGTPSVQLLLLALDVLGVVTLGRVLEVPVMDVTVAGAQGLPEK
AYLSLRAGDVRKQTQYKPGECFSFDGKQVPRHLVVDVFEKVGTAQVSISELSNCDGGFVQ
LQGRDGKIVLDMQAKVRSQMPEPKKRVSRHQAAIDAQQYLEAHSVQRVLQGMVHELLSNR
PSDPYSFMLGYIQASQVNRPTPIPSPFQPARGPDEDDLPNWSAMPGRGDSEYPGFPADGS
QPLPDLSRHHSTLAHVLKEQPMLYEHLKDVRTPNGVSLAQCIKPGIDNRGHPILRTLGLI
AADETCFEVFEPLFRSVMDRWYESILQDVQLPSAVDTRQAGESLRTLSASLLFVQVTCSR
NIRGIQMPPSAQREERKEAERVALEALLSVEDELLNGGEYFPLRGSETYPSKPKGMSPSS
EQKLKGEDALEGSEALGGEDASRRRIGVVKTASEDTLRGYGPGWVEQRGVTGSSSRGGGL
WERGWLQEESKATIQGQWTKVTMHRRQQTPEAQPDATAAGGIPLDQVDLVVRRRLEQALN
GVFGRLLQTTERAAAAAEVQANVTKSETLLKSIKCEVWRPANRQEELKTWREWWLQFSTW
LLAVEPAYEKDFQEMDIDTPVDSVLMDDATLARSQRLYAVLCSLVKNRPLLIVRAYDSTK
EGFEALRMLRREMEPKEKTRSLALMRRLAAWEFHGGQGPYEQLIKYEEALKQYEYQDIRE
WVLQYESLNAPWSSSLLGGAGSKARGNKDEAQPMDIDRIKGKDSKGKGKDGKGKKGKGGK
NDGYKGYGKWSSKDYNTGTGKGKGSKDGKGKDAKGKGKDSKGKGQGSLCHTCGQPGHWKN
ECPWKGSAGSWKQGVRQVEETSQTANPGSSSAQSTVSTSASAYRTPSTINQIRAASAVEM
STPPGCKEALVYDMTGDDGDLEDFALEEPGLDDPGRCPGRPGIPHGDPRRGVHGDQLISM
VETGDGGHVVLKEWLELGERGRPAKDHNKWGEHPVALRRNTLVLSAVIGAISLMDSGPLP
PELEEFSGHQGWHILPSGLPVLINNNVSEAERDTGGGIGVEVDDLMGERDPRGHEEEVEQ
DGTLDNVELSVATPLKELKLLCDRLGVAKSGSKNKVLKRLRDHRDVMERQLATDVAKQLY
KDRDRDPVAMRTPVLPSARQQELHALTHQPFAPWCAACVMGRSRQSPRVGETGANQGHSE
EPEWDERGDRPPELSPAELEPLDHKSDRAEVERLISMGALRAPRPEEDGGVGEAPFILER
LLPGQRVAAAEWFQYVKEMLVEAKLENFENEPLAARDKVLEVLKKKVEVKVSDPFGPGSE
LEFLKRRYIWCSEGAIMMSGTKHLEGLLDALGHDIKERDAPADTSFVEEDKGEELNEAKK
KLYQECVGRLLYLSHTLADIQYSVSVLAGKMAKPTTTSMRWLVRVAGYLKRVPDLGFLIK
PLVPDANLEYGGHGKLVAGSTVVLESVSKSIALSSGESEFVAMVSGATELVFLKDCLGFM
LKDKMAIEAKVRSDSAAAQGMAQRLGTGRVRHLACGMMWLQASVKSKLLKIGSISGSTNP
ADLGTKVLAGPKVRQLLYYAGARLEDGTAYGQLEAEEAERRARINQVVTSGVKKPSLKHA
SSTRGKGEVAVQATIRSREEQKWADEYTDKVNYLKEVLSTERAEKEQMERALKQLREDNR
AAGELLEEPQSGLLLSSGLGRHWPEARGVFTNGSGMVVFVNEADHLRMAYQRRDGDVWKA
LDGTLRLERALAVALEVNGL
Download sequence
Identical sequences A0A1Q9CYM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]