SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9D2L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9D2L7
Domain Number 1 Region: 39-397
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.29e-50
Family AAT-like 0.00076
Further Details:      
 
Weak hits

Sequence:  A0A1Q9D2L7
Domain Number - Region: 1053-1085
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000602
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9D2L7
Sequence length 1157
Comment (tr|A0A1Q9D2L7|A0A1Q9D2L7_SYMMI) Putative alanine aminotransferase, mitochondrial {ECO:0000313|EMBL:OLP89429.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene29132 OC=Symbiodinium.
Sequence
MWKRASKAVGARPLTFHRQVAKSTQEQRQSVVLSLMSNPALMEDAASLYPSDVLARAKEY
VGKNPKFGAYSHSKGILHFRREVAKYINRRDGPSVPPADPEEIYLTDGASAGVKTVLEVM
IDGPLDGLLIPIPQYPLYSASITRLGGTHIGYELVEDGSQLRRLRTAGWAIDVDLIEEKI
KAFIAGGGRPKGIAVINPGNPTGNVLSRETIERIVRFAHVVVRSWGHDIVRKEEEEEEEE
EECRFHSMSKGYYGECGLRGGVLQMTNIDPDVADQIYKLFSMILCANTLGQGAMASILNP
PVEGDASFALFSKERSEILASLSKKAELVSQALNEIPGIQSLPVEGAMYAFPQVYLPERF
VKESEATGVIVVPGSGFGQRNGTWHYRITILPEEGKLRYLGPGERAIEDKTPTPCLPLGS
GHMCCGLESGEIRRIWQLRVSRYIEYLPEFKASKQHELVVFKAAQNEIVKRKQHVIYEAS
AAIAQAGYKIAVVLVDNLPSIAKGRSHGRFLKEGRYASDEYIESTFKNVPENYAKLKELP
EVTEAYYCDNSCAEGLCPKCWLDKGTRNSGKYTHDVQWSWLTGKARRSDFTLPQGLKLYY
PRLTSEAGEDARNISFAAPQIETRATPFPVQVAAMGNSCCCGREKVDDRCSKKNVAYELI
DRAYEKRYGSQRPQPTTPWHSLPPLPWEKDEVIAFKLMVAVPFEDGPGKWTRRGEWTQQG
NCGNYTDIARQAAPTVAVAPQLRSSLPAILGTEQRPKERQPSLPQETFPAGQRQLQVSGS
EGKAVWTLGWCSQTFRANVCVQRSCISFPPPDVGAATQFTGGVSVSTYVKSAMGAAQTLE
FKMDIGGAIKDCGSDIDAMATFSINRFNACLALDFTNQILHLVVGYSCFSVAKLWYFPFI
GKITLTGCSKSRSLQYVYRRAQGWSHSDMYKTAHQCWEAVVRMEIRVDTAEGYAAPKDTF
LSMRIGEFQKQSRFDTSKTYKFPKLEDPTGLARIEVFQRVGHLTVSLGKLQQGEQSVEVP
VNMPGMPNLPMRIQLHGGEVDMEPKLKSTKVKTKYLAEHQLEEVITDVVREVIHEKPAEP
LLFLSSQRPPGSPGSFRANLERIEDQREVPPPPLMEKPQHTGEPPRFPAFDCGLVSWLHG
WAGGAGEALRQDWWFNE
Download sequence
Identical sequences A0A1Q9D2L7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]