SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9E258 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9E258
Domain Number 1 Region: 2139-2196,2299-2338
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000388
Family hypothetical RNA methyltransferase 0.051
Further Details:      
 
Domain Number 2 Region: 62-164,1135-1342
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000000699
Family PBS lyase HEAT-like repeat 0.074
Further Details:      
 
Domain Number 3 Region: 2624-2726
Classification Level Classification E-value
Superfamily EF-hand 0.00000000259
Family Polcalcin 0.072
Further Details:      
 
Weak hits

Sequence:  A0A1Q9E258
Domain Number - Region: 2318-2336,2379-2466
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000122
Family Ta1320-like 0.088
Further Details:      
 
Domain Number - Region: 1677-1713
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9E258
Sequence length 2971
Comment (tr|A0A1Q9E258|A0A1Q9E258_SYMMI) Pentatricopeptide repeat-containing protein, chloroplastic {ECO:0000313|EMBL:OLQ01512.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene15754 OC=Symbiodinium.
Sequence
MCCSAIESAITVAAQRLGHPEDVTRLAAQTALEQLGGVSGNRKSGSEASGNLYEAARAAA
EALSSEEPAIRQGAQRILVNLAGEGPTQRYAAAAFAVSGLKSENPDVLADAADTFVRLGA
EGDPDVLEAVGATLTSGSAQSKEVALKILAALSPPGSLSDAVSVEQGEEGGLRLRRLFXF
APLADQSCLKNNCAVVLPYLDASSARRPHQMILDETVWWSTYELISGLELGASETIIGGT
WDMDPACNKCRLSDVKEATKANLASQSLHFVLCRHDCPGPVFDVAMTPLRTGGTASDTLE
FAGRVLQASTEAHGGLPPLAICFDNGGGNAGINRALLGIASEKELILGGNEPLPEQAATF
WKQCSVIETNLPLFGYGHLQFSGHAGSKHSIFGSNDYHHCLKRLALHLCSGTRVVQWGSV
SNCLTPLLSGGLNARAYCSTDPQSDKQASQKLCVGYLTGRWEELGALVSMLVASLLASAW
QASPAFEVQDHFLNSMSAYYFLLINLSESRAKGSAQGAARFLPLPTCKLLLTLAGELYEP
RYRCEAQIERHFSRVKAGTKGQPHLVHGILGTTQVHLKQVRQKTKLRGGREMQALTESEA
AALSKHALVSAAALQSALSLDRTPEQVLTHVTAWWHAEGAKLICGAENPSTKRPDEMQDV
IDAMDAFVADNWDVEAEAWVEEGLAEALQADDEPDTTPNTMPVGGEAHVMEALQHRLDQR
RELLAMQSEAEAEAADADAGPLSSASVLASVEEEAEEAEEAVTAASGVGQDICQDDIRNL
PDILGYIRKGQSAATAEVSLCKRLEDLRAPLTCFVRKVQLAEKTLSPSTIMGNAGGVPLN
SRNLLRHNLRKAADFTTSGSRQSRFAYWAATVKSARPAGSIKDASTFRPWSVDSPQVVAY
VLTEGGGNRLRLGEVLSVFRGAVVKADTRRMRVSKPMTDSLSAKHTARLHIRELQDIGRG
KFLLCPSSPVHIVDPCGSVLGEVPASKTSASMHSVWTVNQETLRKMSHVDVGMVSDWDGL
GIAEGDRQYNVNSFMKNDAGFQAIEDYFRGLASLHDKVYGQRLLDDQQTVTIQKQSVKWE
DLVLRSSLYFQQKFGGSSRDFSHKVYNKFASVVPGEVLHAWGLAKGTRWNAEVAVRQRVA
RCLCDKAQDVRLAAIPAFARLLRAADQATVSQVALNLPSLPSEVRRDCLEALALVWSSPG
SASGPEEASAVASCLEDRSLEVRRLAITLLRTCQARGNEDAVLAVASRLRHAQPEVRAAA
VEGLAAIACAEGPLDYDRGAVAAAAAHLDSDRWEVRKSAVQAILGLVPVKIHAFLPSLVS
VVGVQSDQIWAQQSDVINSMAKGGPPMPEQPLSDNLPLDIHVIIKKAGTQRCRKHWYLPC
LNPAGPPEAVAAKAAPGPPPPAPKTAAASMAAPMALLRLPSMTVYSNIMLFLRLLKLTGG
SRSLHRELVKQAYLILLYRQTEGFSLKEVQAIRGICGREEYSVGNKAAFLCPYQSCGARP
SKARRCVGIRSCVPAHRIADGAPCNLRACNEQTKTDCPSPEVVETEGIPEGCVLSVRAGA
TRRQAPVSSDRPFRFNCTAAEATPFKVDVLEPVATARLILRPGEEKRTDCQYTIPLEASN
SFEGSAPSPPASPPQGSGDMFVTIAVSPSDEAQEEQQQDTSDKGNTSAASRIGQASAARE
YLDKHNLVEFTQLLVQSVIKEQPEKPYEFMARQHKALWGTLEMQEVTVDMRGALFYFYLH
CSVPQSLGTASRQLMAVAAARQAPGAPKPRPKQSDEARELLRLGVEPKFPEVVEVLGPVL
DEWATQPQLATATLGSLGKARRSITAQRVLQVMELASLEPNVFHYSAGIVASEKSHDWQR
AMSMLEQMQVVEVAPNEYSFSAAIKALSSAVQWQRALQTLGLAQDRQSCNVVGFSAVMGA
CVKATQWTEALDIFSQIWWAEESPDTLCYNAVLNACQAGRSWELAVDLLQEMYVTALQPN
TYSHNILLGSLAKATQWENTLALFSDDPWLRFAADAATYNAAAPAFAQSAQWRAAVHLLG
HASAKGIGVERGALDAALRACENCGQWAQVLALQPALQRLCRPDPDEVALLEVTMDGPGE
LTEPMANALRFQWLYGYPGVPEGQEQLTHGFFKYFASMQAMAARQLLWLNPSASTVLDPF
CGSGTVLIEAALAGKAATGSDASPLAAFVARHHTDVERISLDELRAQARALAPEKELSWD
DLRGRLGASKEDPVTSALWFCLLVALQRAGGQDVFALSGSKGFGASQSWGDPPRKLCPPM
FMGTVELYAAQLSALRSSMPFPDLVRTGCGDARTLQLSRPVEAVITSPPCPGAYSYATAA
RLSQGWLAGAAEVFGPSEDATRMESMEIGSLSLMETAPEEFAASWRKQQEEWLQAVWNNL
VPEGTATLMIGDGADLDNLASTKEAAEAVGFAVLATATIRMTRDMPRRVDSRGVRRTQHV
VHLRKRFYFPEPEPRPRPPPMSAEDERGRLMFGVTMATVGGQDRNEQSETAGNGRVIGAP
VPARQLLAFVSWRWGTSLQTENEETVQRAGDIGAKVYLGIHGVFGKGRSISVVCLCRQGT
VSSRIDQASCGYRLPEAQGRKGLPCFKLKDVLLLFFGLHGREITDLLCKQVMETHPDPQY
LMPLSEVLLWARRRRDAEFKLFQQQYEKFDTNRSGLIEFAELTKLVGQLGFTVSQAAVQE
LLNESEDTLFGVGRKDGKLDFDEFAMDRSLAVAISFSSLPGVAHAVCLERGLMADKRKKL
FYPAGPLTARHTKKQEWLVPESESVWSKSGPPTSEARKLKSDVALPLVNLNDPARKAAKA
CVEMRRDLNTLVRQRGGRTPAGLILQPDFEKDPQVEQKPPDEYLVARYEKEGSVQSVAVF
HDRDPARSEHESKAKVCTLPQYVDEYGGLGIMDKDVYSILAANHKVEDRDLWDSLEYSSL
TSQGDVFAKTMAKLNQRRALDDAGDGGEEPR
Download sequence
Identical sequences A0A1Q9E258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]