SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Q9E545 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q9E545
Domain Number 1 Region: 513-576
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000001
Family Cold shock DNA-binding domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 229-277
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000539
Family Cold shock DNA-binding domain-like 0.004
Further Details:      
 
Weak hits

Sequence:  A0A1Q9E545
Domain Number - Region: 121-156
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00186
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.01
Further Details:      
 
Domain Number - Region: 781-832
Classification Level Classification E-value
Superfamily Prefoldin 0.0235
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q9E545
Sequence length 841
Comment (tr|A0A1Q9E545|A0A1Q9E545_SYMMI) Uncharacterized protein {ECO:0000313|EMBL:OLQ02523.1} KW=Complete proteome; Reference proteome OX=2951 OS=microadriatica). GN=AK812_SmicGene14627 OC=Symbiodinium.
Sequence
MEVLVSAHPGISDDCIVSVRCGSTRRQAPLDIARCQALKFPSNLETLNEPLKIDVLKPVA
SARLVLHPQQDEYFMNFLDKPDMAIGLNVQPASQTSEGVADAGTAGHHPGRKQGQSQGPA
SARDYLELHGVLKYVQSMLTALIQTKPKDPYDFMLHQLSSSTSCASARQPETGPEDQALR
ADAESPEAVPASPPKGPTNLPAQPNADGNREVIQSPQGQLGDSGSCIIAGWGFVECNGQD
SFLHNKELKGQCPSAGDQVSFKVEPSEKGTVATEVTVQVSSEEAPPVPPPQCKAPPPPLP
EPELRGLPLAVANLRCVLQSARAGGWVAWRDLAAEMTVEDRLALAEFSSALMVVEPARMP
NAAALAETMRRRLPATAATASQVPQGSTSTSTPTPRTPSRTRTPASSSTTLGAPPSAWMA
GVQWQSPTAQQPHDDGVSGSVFLDAPPPDRSQPTGAAFLQTAVSTPASTTPGDGTPWGLT
PEMVRQGIARMEAESAAISAAQTPGVTIQIAFYAGEIKRFNPVKGYGFISCEAFPEQDVF
VLKSELPQGFGPEGGRCKFKVAKEEKGPVAKQVQLLGAAEQMRSWPQQDFPVSPQPPPGN
PFHLPGSRADSDHQTHQTPAAVPPSAEPAELTEPAPVPVAAWQDAAPGAQAETHSTQREA
LAEDTTALTAHSEEEASRIRLQTVLLKAGKNGVLEEILQNLFRSRACSCELSSQQLGQPG
DGQKIGPTPLVVDEQTESGGLGEGDASQLRAHVRERLTNAWTTGELKQAVQEALEHNGPK
IAEATAEQSIQFLQDEIKIMAEESKVLHEQVDRLSSEMQRLLLTNQQLLNQIQSGESASK
R
Download sequence
Identical sequences A0A1Q9E545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]